KEGG   Bacillus subtilis subsp. subtilis 168: BSU33070
Entry
BSU33070          CDS       T00010                                 

Symbol
gerAC
Name
(RefSeq) spore germination protein A3
  KO
K06290  spore germination protein AC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU33070 (gerAC)
SSDB
Motif
Pfam: Spore_GerAC
Other DBs
NCBI-GeneID: 935951
NCBI-ProteinID: NP_391187
Pasteur: BG10387
BSORF: BG10387
UniProt: P07870 A0A6M4JP26
Position
3393293..3394414
AA seq 373 aa
MKIRILCMFICTLLLSGCWDSENIEELSLVIGIGLDKPDDENLELTQQILVPKIISAKEG
SSSDPTQLSITKGKTVHQMMRTSALKHKPTFSQHLRLILLSKSVIADQIGMDAIINQFVR
DNGTRRSSYVFITNGRTKDIFNMNDEGEPASNVIYDLTENNKVTIRTMEPVTLGEISEHL
TSDDSFLIPHVGKENGKLAINGASIIKNKLWHRDLTPIEVQNISLFSGTVEGGVIDLKRD
GHLFSYEVYSSNRKIKTAYKDGKFKFTVTRNIEGRLSEDWNPNEDSFKDSYIKSIEKTVE
KRVHETVTSFITEKLQKEIKADVTGLGNEVRIHYPQKWKKISRKWDDDYFSNAEIDYRVN
VIVRDFGTKGANK
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaaatccggattttatgtatgtttatatgcaccctattgctgtccggatgctgggac
agtgagaatatcgaggaattaagcttagtgatcggaatagggctagacaagcctgacgat
gaaaatttagagctgacacagcaaattctcgtgccgaaaataatcagcgccaaggagggc
tcttcatctgatccgacacagctttctatcacaaagggtaaaactgtccatcaaatgatg
agaacctctgcattaaagcataagcctacgttttcacagcatttgcgtctcattctgctt
tccaaaagcgtgattgcggatcaaattggaatggacgccattattaaccagtttgtcaga
gacaacggaacaaggaggagttcctacgtctttatcaccaacggccgaactaaggatata
tttaacatgaatgatgaaggcgaacccgcatccaacgtgatatatgatctgacagagaat
aataaggtgacgatcagaacgatggagccagttacattgggggagatctcagaacactta
acctctgacgattcattcctcatccctcatgtcggtaaggaaaacggcaagctcgcgata
aacggagcctctatcataaaaaataaattatggcaccgggacctcaccccgattgaggtt
caaaatatcagcttattttcaggcactgtcgagggaggcgtcattgacttgaagcgcgat
ggccatctcttttcttatgaagtatattcaagcaatcggaagatcaagacggcatacaag
gacggaaagttcaaattcaccgttacccgcaatattgaaggtcgtctatctgaggactgg
aatcccaatgaagactcgtttaaggattcatatattaaaagtattgaaaagacagtcgaa
aaacgagtacacgaaacagtaacgtcatttattacagagaagctgcagaaagagatcaaa
gcggacgtaaccgggctgggaaacgaggtcagaattcattatcctcaaaagtggaaaaag
atttcaagaaaatgggatgatgattatttcagcaatgcggaaatagactaccgggtcaat
gtgattgtcagagacttcggaacgaaaggcgcaaacaaatag

DBGET integrated database retrieval system