KEGG   Bacillus subtilis subsp. subtilis 168: BSU33070Help
Entry
BSU33070          CDS       T00010                                 

Gene name
gerAC
Definition
(RefSeq) spore germination protein A3
  KO
K06290  spore germination protein AC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU33070 (gerAC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_GerAC
Motif
Other DBs
NCBI-GeneID: 935951
NCBI-ProteinID: NP_391187
Pasteur: BG10387
BSORF: BG10387
UniProt: P07870
Position
3393293..3394414
Genome map
AA seq 373 aa AA seqDB search
MKIRILCMFICTLLLSGCWDSENIEELSLVIGIGLDKPDDENLELTQQILVPKIISAKEG
SSSDPTQLSITKGKTVHQMMRTSALKHKPTFSQHLRLILLSKSVIADQIGMDAIINQFVR
DNGTRRSSYVFITNGRTKDIFNMNDEGEPASNVIYDLTENNKVTIRTMEPVTLGEISEHL
TSDDSFLIPHVGKENGKLAINGASIIKNKLWHRDLTPIEVQNISLFSGTVEGGVIDLKRD
GHLFSYEVYSSNRKIKTAYKDGKFKFTVTRNIEGRLSEDWNPNEDSFKDSYIKSIEKTVE
KRVHETVTSFITEKLQKEIKADVTGLGNEVRIHYPQKWKKISRKWDDDYFSNAEIDYRVN
VIVRDFGTKGANK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccggattttatgtatgtttatatgcaccctattgctgtccggatgctgggac
agtgagaatatcgaggaattaagcttagtgatcggaatagggctagacaagcctgacgat
gaaaatttagagctgacacagcaaattctcgtgccgaaaataatcagcgccaaggagggc
tcttcatctgatccgacacagctttctatcacaaagggtaaaactgtccatcaaatgatg
agaacctctgcattaaagcataagcctacgttttcacagcatttgcgtctcattctgctt
tccaaaagcgtgattgcggatcaaattggaatggacgccattattaaccagtttgtcaga
gacaacggaacaaggaggagttcctacgtctttatcaccaacggccgaactaaggatata
tttaacatgaatgatgaaggcgaacccgcatccaacgtgatatatgatctgacagagaat
aataaggtgacgatcagaacgatggagccagttacattgggggagatctcagaacactta
acctctgacgattcattcctcatccctcatgtcggtaaggaaaacggcaagctcgcgata
aacggagcctctatcataaaaaataaattatggcaccgggacctcaccccgattgaggtt
caaaatatcagcttattttcaggcactgtcgagggaggcgtcattgacttgaagcgcgat
ggccatctcttttcttatgaagtatattcaagcaatcggaagatcaagacggcatacaag
gacggaaagttcaaattcaccgttacccgcaatattgaaggtcgtctatctgaggactgg
aatcccaatgaagactcgtttaaggattcatatattaaaagtattgaaaagacagtcgaa
aaacgagtacacgaaacagtaacgtcatttattacagagaagctgcagaaagagatcaaa
gcggacgtaaccgggctgggaaacgaggtcagaattcattatcctcaaaagtggaaaaag
atttcaagaaaatgggatgatgattatttcagcaatgcggaaatagactaccgggtcaat
gtgattgtcagagacttcggaacgaaaggcgcaaacaaatag

DBGET integrated database retrieval system