KEGG   Bacillus subtilis subsp. subtilis 168: BSU33080Help
Entry
BSU33080          CDS       T00010                                 

Gene name
liaR
Definition
(RefSeq) transcriptional regulatory protein LiaR
  KO
K11618  two-component system, NarL family, response regulator LiaR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00481  LiaS-LiaR (cell wall stress response) two-component regulatory system
bsu_M00754  Nisin resistance, phage shock protein homolog LiaH
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33080 (liaR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU33080 (liaR)
Two-component system [BR:bsu02022]
 NarL family
  LiaS-LiaR [MD:M00481]
   BSU33080 (liaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_24 HTH_40 HTH_23
Motif
Other DBs
NCBI-GeneID: 935957
NCBI-ProteinID: NP_391188
Pasteur: BG14133
BSORF: BG14133
UniProt: O32197
Position
complement(3394422..3395057)
Genome map
AA seq 211 aa AA seqDB search
MIRVLLIDDHEMVRMGLAAFLEAQPDIEVIGEASDGSEGVRLAVELSPDVILMDLVMEGM
DGIEATKQICRELSDPKIIVLTSFIDDDKVYPVIEAGALSYLLKTSKAAEIADAIRAASK
GEPKLESKVAGKVLSRLRHSGENALPHESLTKRELEILCLIAEGKTNKEIGEELFITIKT
VKTHITNILSKLDVSDRTQAAVYAHRNHLVN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgagtattattgattgatgatcatgaaatggtcagaatggggctcgcggctttt
ttggaggcgcagcccgatattgaagtcatcggcgaagcatcggacggcagcgaaggtgtt
cggcttgctgtggaactgtcgcctgatgtcattttaatggaccttgtcatggagggcatg
gatggcattgaagctacaaagcaaatttgccgggagctttccgacccgaaaattattgtg
ctcactagcttcattgatgatgacaaagtgtacccggttattgaagctggcgcgctcagc
tatctgttgaaaacctcaaaagcggcagaaatcgccgatgccatccgcgccgcaagcaag
ggagagccgaagctggagtcaaaagtggcgggaaaagtattatccaggctgcgccactca
ggtgaaaacgcgctcccgcatgaatcgcttacaaaacgggagctcgaaatactctgcctg
atcgcagaaggaaagacaaacaaagaaataggcgaggaactgtttattacgattaaaaca
gtcaaaacacatattacgaatattttatcaaagctggatgtcagtgaccggacgcaggcg
gcggtgtacgcacaccgaaatcatctcgtgaattag

DBGET integrated database retrieval system