KEGG   Bacillus subtilis subsp. subtilis 168: BSU33090Help
Entry
BSU33090          CDS       T00010                                 

Gene name
liaS
Definition
(RefSeq) sensor histidine kinase
  KO
K11617  two-component system, NarL family, sensor histidine kinase LiaS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00481  LiaS-LiaR (cell wall stress response) two-component regulatory system
bsu_M00754  Nisin resistance, phage shock protein homolog LiaH
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33090 (liaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU33090 (liaS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU33090 (liaS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU33090 (liaS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  NarL family
   BSU33090 (liaS)
Two-component system [BR:bsu02022]
 NarL family
  LiaS-LiaR [MD:M00481]
   BSU33090 (liaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 HATPase_c HAMP DUF4510 HATPase_c_2 DUF1681 TF_AP-2 HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 935967
NCBI-ProteinID: NP_391189
Pasteur: BG14134
BSORF: BG14134
UniProt: O32198
Position
complement(3395035..3396117)
Genome map
AA seq 360 aa AA seqDB search
MRKKMLASLQWRAIRMTTGISLLLFVCLISFMMFYYRLDPLVLLSSSWFGIPFILILLLI
SVTVGFASGYMYGNRLKTRIDTLIESILTFENGNFAYRIPPLGDDEIGLAADQLNEMAKR
VELQVASLQKLSNERAEWQAQMKKSVISEERQRLARDLHDAVSQQLFAISMMTSAVLEHV
KDADDKTVKRIRMVEHMAGEAQNEMRALLLHLRPVTLEGKGLKEGLTELLDEFRKKQPID
IEWDIQDTAISKGVEDHLFRIVQEALSNVFRHSKASKVTVILGIKNSQLRLKVIDNGKGF
KMDQVKASSYGLNSMKERASEIGGVAEVISVEGKGTQIEVKVPIFPEEKGENERDSSIID
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaatgcttgccagcctccaatggcgcgccatccgcatgacaacgggaatc
agcctgctcctttttgtttgcctgatttcctttatgatgttttactatcggctcgatccg
cttgttttgctgtcatcaagctggttcggaattccgtttatcctgattttgcttctgatc
agcgtgaccgtcggtttcgcctcagggtatatgtacggcaaccggttgaagacaaggatt
gatacattaattgaatccattttaacctttgaaaacggcaatttcgcttatcggataccg
ccgctcggtgatgatgaaatcggcctggctgctgatcagctgaacgaaatggcgaagcgc
gtggagcttcaagtcgcatccctccagaaactttccaatgaacgtgcggaatggcaggct
caaatgaagaagtcggttatctcagaagaacgccagcgattggccagagatcttcatgat
gcggtcagccagcagctctttgccatatcgatgatgacatcagccgtgctggaacatgtc
aaggatgctgatgacaaaacagtcaagcggatcaggatggtcgagcatatggcaggcgaa
gcccaaaatgagatgagggcgctgctgctccatttacggcctgttacccttgaaggaaaa
gggctgaaggagggccttacggagcttttggacgagttccgaaaaaagcagccgattgat
attgagtgggatatacaggacacagcgatatccaagggtgttgaagaccacttgttcaga
atcgtgcaggaggccctttcaaacgtatttagacattcaaaagcgtcaaaagtaaccgtg
attctgggcataaagaacagccagctccgtctgaaggtgattgataatggaaaaggcttt
aaaatggaccaggtgaaagcctcctcatacggcttgaattctatgaaagaacgtgcaagt
gaaatcggcggtgtcgccgaagtgatttcagtagaaggaaaaggcactcaaatcgaagtg
aaggtcccgatttttccggaagaaaaaggagagaacgaacgtgattcgagtattattgat
tga

DBGET integrated database retrieval system