KEGG   Bacillus subtilis subsp. subtilis 168: BSU33100Help
Entry
BSU33100          CDS       T00010                                 

Gene name
liaF
Definition
(RefSeq) LiaR negative effector LiaF
  KO
K11622  lia operon protein LiaF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33100 (liaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2154 Halogen_Hydrol
Motif
Other DBs
NCBI-GeneID: 938469
NCBI-ProteinID: NP_391190
Pasteur: BG14135
BSORF: BG14135
UniProt: O32199
Position
complement(3396114..3396839)
Genome map
AA seq 241 aa AA seqDB search
MTKKQLLGLIIALFGISMFLQIIGIGDLLFWPLFFLIAGYFLKKYSRDWLGSVMYIFAAF
LFLKNLFSITFNLFGYAFAAFLIYAGYRLIKGKPIFEPNEKQVNLNKKEHHEPPKDVKHP
DMRSFFIGELQMMKQPFDLNDLNVSGFIGDIKIDLSKAMIPEGESTIVISGVIGNVDIYV
PSDLEVAVSSAVFIGDINLIGSKKSGLSTKVYAASTDFSESKRRVKVSVSLFIGDVDVKY
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaacagcttctcggattgatcattgctttattcggcatcagtatgtttttg
caaattatcggaataggcgatctgctgttttggccgctcttttttctgattgccggctat
ttccttaaaaaatattcccgtgattggcttggctccgtcatgtatatctttgccgcgttt
ctatttttgaaaaacctcttcagcatcacctttaatttattcggctatgcgtttgccgca
tttctgatttacgccggctacaggcttatcaaagggaagccgatatttgaaccgaatgag
aaacaggtcaatctcaataaaaaagaacatcatgagccgccaaaagatgtaaaacatccc
gacatgcgcagcttttttatcggtgagctgcaaatgatgaagcagccgtttgacctgaac
gatttaaatgtctctggttttatcggtgatatcaaaatcgatttatctaaagcgatgatt
cccgagggagaaagtacaatcgtcattagcggagtcattggtaacgttgatatttatgta
ccatcggaccttgaagtggctgtcagctcggctgtttttataggagacattaatctgatc
ggctcgaagaaaagcggattaagcacgaaggtatatgccgcgtcaactgattttagcgag
tcaaagcgccgggtaaaagtgtccgtttccttatttatcggtgatgtggatgtgaagtac
gtatga

DBGET integrated database retrieval system