KEGG   Bacillus subtilis subsp. subtilis 168: BSU33110Help
Entry
BSU33110          CDS       T00010                                 

Gene name
liaG
Definition
(RefSeq) protein LiaG
  KO
K11621  lia operon protein LiaG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33110 (liaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4097 DUF3540 PilX_N
Motif
Other DBs
NCBI-GeneID: 938471
NCBI-ProteinID: NP_391191
Pasteur: BG14136
BSORF: BG14136
UniProt: O32200
Position
complement(3396873..3397745)
Genome map
AA seq 290 aa AA seqDB search
MKKMLGKLLITAGILVFFAVVVKDVFAAGLGFINGTEADSASASPRDIDSMVIESDSKDV
RIIAEERSDISAGISGDSGKLFVTENKRKLELTVKEKEFQFLNGFNRSTLIVRLPYDYKG
DLAVRTSSGDVSVAGNDHLALSGLNAVSASGNTSVTDVRIQDLKVKASSGDVSISNTVSK
TAGIDLASGDANLVHVSGSLDVKMTSGDFNAVLKKVTGPVSVTLTSGDANVSLPQNGSFA
VNALSASGDVSSPYSFADKGHKEQHHITGTQGSGRHPIDIKTDSGDLAIR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgcttggcaaactgttgatcactgccggtattctggtttttttcgccgtc
gtcgtaaaagatgtgtttgctgcaggcctaggtttcataaatggcacagaagctgattca
gccagcgcatcgccgcgggacattgacagcatggtcattgagtcggatagcaaggatgtc
cggattatagcggaagaacgaagtgacatatcggcaggcatttcaggagactcaggaaag
ttatttgttactgaaaacaaaagaaaactggagctgaccgtaaaggaaaaagaatttcaa
tttttgaatggatttaaccgttcaactcttatcgtcaggcttccgtatgattataaaggt
gatctggcagtacgaacctcaagcggtgacgtgtctgtggccgggaatgaccatcttgcg
ctttccgggctgaacgcagtatctgcgagcggaaatacgagcgtgacggacgtccgcatt
caagatctgaaagtgaaggcatcatcgggggatgtttccatttcaaataccgtctccaaa
acagccggcattgatttagcttcaggggacgcaaatctggttcatgtatcaggctctctt
gatgtgaaaatgacttcaggagattttaatgctgtattgaaaaaggtaaccggtcccgta
tctgtcacgctgacaagcggtgatgctaatgtaagccttccccaaaatggcagctttgca
gtcaatgctttatcagcaagcggtgacgtcagttcgccgtattcatttgctgataaagga
cataaagaacagcatcacatcacaggcacgcaaggaagcggccggcatccaatcgacatc
aaaacggacagcggggatctagcgatacggtag

DBGET integrated database retrieval system