KEGG   Bacillus subtilis subsp. subtilis 168: BSU33120Help
Entry
BSU33120          CDS       T00010                                 

Gene name
liaH
Definition
(RefSeq) lia operon expression modulator LiaH
  KO
K11620  lia operon protein LiaH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00754  Nisin resistance, phage shock protein homolog LiaH
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33120 (liaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspA_IM30 FTA4 Spc7 Prominin SlyX HORMA
Motif
Other DBs
NCBI-GeneID: 938585
NCBI-ProteinID: NP_391192
Pasteur: BG14137
BSORF: BG14137
UniProt: O32201
Position
complement(3397846..3398523)
Genome map
AA seq 225 aa AA seqDB search
MVLKRIRDMFVASVHEGLDKMENPKVMLNQYVRDMESDIAKAKQTIVKQHTIAYQFKKKY
EEAAEVAGKRKNQAQLAFDAGEEELAKKALTEMKYLEGKAAEHKASYEQANSQLADLKEQ
LAALETKLQDVKDKKQALIARANAAKAKEHMNTTFDKIDSESAYREFLRIENRIEEMEIR
ANYSKSAEAGTELTRKEFADDVEAEIEKMRTLSLQKSDQTKAANE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtattaaaaagaatcagagacatgtttgttgcgtcagttcatgaaggacttgataaa
atggagaatccaaaggtgatgctgaatcaatatgtacgcgatatggaaagcgacatcgca
aaagcaaagcaaacaattgtgaaacagcacacgattgcctatcaatttaagaaaaaatat
gaagaagccgctgaagtggctggcaaacggaaaaatcaggcacagctcgcatttgacgca
ggtgaagaagaactggcgaaaaaggcgctgactgaaatgaagtatttagaagggaaggcg
gctgagcataaagcttcctatgaacaggcaaacagtcagctggctgatctgaaagagcag
ctggctgcacttgaaacaaagcttcaggacgtaaaggataaaaaacaggcgctgattgcg
cgggcaaatgcggcgaaagctaaagagcatatgaatacgacatttgacaaaattgacagt
gaaagcgcgtatcgtgaatttttacgtattgaaaatcgtattgaagaaatggaaatccgc
gcgaattattcaaagtcagcggaagccggcacagaacttacacgtaaagaattcgcagac
gatgtggaagcggagattgaaaaaatgcggacactttcactgcaaaaatcagaccagaca
aaagcggcaaatgaataa

DBGET integrated database retrieval system