KEGG   Bacillus subtilis subsp. subtilis 168: BSU33130Help
Entry
BSU33130          CDS       T00010                                 

Gene name
liaI
Definition
(RefSeq) protein LiaI
  KO
K11619  lia operon protein LiaI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00754  Nisin resistance, phage shock protein homolog LiaH
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33130 (liaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA FeoB_associated
Motif
Other DBs
NCBI-GeneID: 935958
NCBI-ProteinID: NP_391193
Pasteur: BG14138
BSORF: BG14138
UniProt: O32202
Position
complement(3398550..3398930)
Genome map
AA seq 126 aa AA seqDB search
MKINKKTIGGFLLIVFGISVFFGGGSFGFIIPLAIGSLMTYAGIKRFAAGKTITGIIVGG
IGAIMLICSLPFVVGIALAAAMVYYGWKLMKNGSADNGVSSFDPEPASAAYQSHFDDEWE
EFLKKK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaacaagaaaacaataggcggattcttattaattgtatttgggatctccgtc
ttttttggaggaggaagcttcggctttatcatcccgctcgccatcgggagcttgatgaca
tacgcaggaatcaaaaggtttgccgcgggaaaaaccatcacgggaatcatcgtgggcggt
atcggagccattatgctcatctgctcacttccgtttgtcgtcggaatcgcattggcggcc
gctatggtgtattacggctggaagctgatgaaaaacggatcagctgataacggtgtatca
tcttttgatcctgaaccggcttctgctgcctaccaatctcactttgatgacgaatgggaa
gaatttttgaagaaaaaataa

DBGET integrated database retrieval system