KEGG   Bacillus subtilis subsp. subtilis 168: BSU33140Help
Entry
BSU33140          CDS       T00010                                 

Gene name
yvqJ
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3
Motif
Other DBs
NCBI-GeneID: 935970
NCBI-ProteinID: NP_391194
Pasteur: BG14139
BSORF: BG14139
UniProt: O32203
Position
complement(3399092..3400360)
Genome map
AA seq 422 aa AA seqDB search
MVNLIESDSIWKRNFNYLFFSRIVKISGDMFAFNSILWFLIYDGKGAIGTALLIAVTFLP
EAVLAPVTGPFMKQTTLKFWMYFSDLTRAAIVLIIPLCHFAGFSPLWFVMTLMIVHSATG
AAYNPASIALIPQIVNEQGIQKANAVLQSSAQIVRLGAVTLCGAFLTFISPSYTMLIALV
LYLVSGFLVLFIKYTAVESQSESAVVTQRGTYIGRLKRGFRLVRKHQILYPLAIYCIFMN
FAAAPWEALSAVYVAEDLNGQPIVYSLLKATTAAGAFLLGFVLAKVKVNRYGLLFVTAGI
IEGFAFFITGMNTFLPLVFFAAFTFGAAVSAVNVPEYTIIQTSVDSEDQPQVYAVIHMIS
NISIPAGAVICGYAANAFGSGKVIAVGGIVEIIAGIGILLFTKLAKAERSDLIKEREASV
HL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatttaattgaaagtgatagcatctggaagagaaatttcaattatctgtttttc
tcaagaatagtcaagatatccggcgatatgttcgcatttaattcaatattatggttttta
atttatgacggcaaaggtgcgatcggcactgctttattgattgctgtcacgtttttgccg
gaagccgttctggcgcctgtgacggggccttttatgaaacagaccacgctgaaattttgg
atgtacttttcagatctgacaagggcggcgattgttttgattatccctctatgtcatttt
gcgggcttctctccgctgtggtttgtcatgacgcttatgattgtgcattcagctactgga
gctgcctacaatcccgcctctatcgctttgattcctcaaatcgtcaatgaacagggcatt
caaaaagcaaacgctgtgctgcaatcctccgctcaaattgtccggcttggggctgtcaca
ttatgcggcgcttttcttacatttattagtccttcttataccatgcttatcgcacttgtg
ctctatttggtgtcaggttttctcgttctttttattaagtacactgcggttgaatctcaa
tcagagtctgcggttgttacacagagaggcacatatatcggaagactgaaacgcggcttt
aggctcgtcagaaaacaccagattttatatccgctcgccatttactgtatctttatgaat
ttcgcggctgccccatgggaagcgctctctgccgtatacgttgcggaagatttaaacggc
cagccgatcgtatactcgcttttaaaggccaccaccgccgcgggcgcgtttttattaggg
tttgtgctggcgaaagtcaaggtaaacaggtacggcttgttattcgtcactgccggcatt
attgaaggatttgctttctttattaccgggatgaatacctttttgccgctcgtctttttc
gctgcttttacctttggtgccgcagtcagtgctgttaatgttcctgagtacacgattatc
cagacgtctgtggatagtgaggatcagccgcaggtttacgccgttatacatatgatctca
aatatttcgatccctgccggagctgtcatttgcgggtatgccgctaatgctttcggctca
ggtaaagtgatcgctgtcggtgggattgtcgaaattattgcgggtatcggaatcttgctg
tttacaaaattggccaaagcagaaaggtccgacctaattaaagaaagggaagcaagtgtt
catctgtaa

DBGET integrated database retrieval system