KEGG   Bacillus subtilis subsp. subtilis 168: BSU33150Help
Entry
BSU33150          CDS       T00010                                 

Gene name
yvqK
Definition
(RefSeq) Cob(i)yrinic acid a,c-diamide adenosyltransferase
  KO
K00798  cob(I)alamin adenosyltransferase [EC:2.5.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU33150 (yvqK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.17  corrinoid adenosyltransferase
     BSU33150 (yvqK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cob_adeno_trans ATP-cone
Motif
Other DBs
NCBI-GeneID: 935972
NCBI-ProteinID: NP_391195
Pasteur: BG14140
BSORF: BG14140
UniProt: O34899
Structure
PDB: 

Position
complement(3400537..3401118)
Genome map
AA seq 193 aa AA seqDB search
MKLYTKTGDKGQTGLVGGRTDKDSLRVESYGTIDELNSFIGLALAELSGQPGFEDLTAEL
LTIQHELFDCGGDLAIVTERKDYKLTEESVSFLETRIDAYTAEAPELKKFILPGGSKCAS
LLHIARTITRRAERRVVALMKSEEIHETVLRYLNRLSDYFFAAARVVNARSGIGDVEYER
SAIVFRDRNSSES
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatatacaaaaacaggcgataagggacaaacgggcttagtcgggggcagaacg
gacaaggacagcctacgcgtcgaaagctacggcacgattgacgagcttaacagctttatc
gggcttgctttggcagagctttccgggcagcccggctttgaagatctgacagccgagctg
ctgaccatccagcatgagctgtttgactgcggaggcgatctggcaatcgtcacagaaaga
aaagactataaactaacggaagaatctgtttcctttttagaaacgcgcattgatgcctat
acagcagaagcgccggaactgaagaaatttattcttccaggcggatcaaagtgtgcttcg
cttctccatatcgcacgcaccattacaaggcgggcagaacgaagagtggtggcgctgatg
aaatcggaggagattcatgaaacagtgctgcgttatctcaatcgtctgtccgattatttc
tttgccgccgcccgggttgtgaatgcaagaagcggtattggcgatgtagaatatgaaaga
agtgccattgtgtttcgggaccgaaacagcagcgaatcataa

DBGET integrated database retrieval system