KEGG   Bacillus subtilis subsp. subtilis 168: BSU33160
Entry
BSU33160          CDS       T00010                                 

Symbol
yvrA
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K25028  cobalamin transport system ATP-binding protein [EC:7.6.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33160 (yvrA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.8  ABC-type vitamin B12 transporter
     BSU33160 (yvrA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalamin transporter
    BSU33160 (yvrA)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_16 CbiZ AAA_22 AAA_14 SbcCD_C AAA_29 AAA_5 Csm1_B AAA_30 MobB NACHT T2SSE DO-GTPase2 AAA_15
Other DBs
NCBI-GeneID: 935968
NCBI-ProteinID: NP_391196
Pasteur: BG14141
BSORF: BG14141
UniProt: O34631 A0A6M3ZJ63
Position
complement(3401141..3402469)
AA seq 442 aa
MKAEGLSGGYGDSRLINNVSLTVEKGEFLGILGPNGSGKTTLLHLLTGTLPAKKGRVYLA
GKLLADYKPKELAQIMAVLPQKMDQAFTFTVEETVAFGRYPFQTGLFRQQTEKGEAIVQE
AMEQTGVADFAQKPIRELSGGEQQRVYLAQALAQQPRILFLDEPTNFLDLAYQKDLLDLI
KRLTRESGLAAVSVFHDLNTASLYCDGLMFMKNGTAGPKQKPEYAVTEQSIKAVYDTDVT
ALVHQSSPKPMIVIQPEKDSVKRQSIPFEALLQAGRDDILLQTEIPLRTLSSTPIGAGFS
WSRTLIHKRLPDQPDPIEGLTACLSESGFQLQETCAMASSERLDRFVYRTYEDGELSVFI
CVQTGFSIWILINGYAADQFFIKALMAAEAERTKVLGDGGGTGDILIAATQTQQSENIEQ
RLNQLIKKGTAECIKEAAELFE
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaaggcagaagggctgtcgggaggatacggcgacagccgcctaatcaacaatgtcagc
ttaacagtggagaagggagaatttcttggaattctcggccctaatggaagcggaaaaacc
acgcttttgcacttgctgacaggtacgctgccggccaagaaaggcagggtttatctggcc
ggaaaactgctggcggactataaaccgaaggaactggcgcaaatcatggctgtcctgccg
caaaaaatggatcaagccttcacctttactgtcgaagaaactgtagcctttggcagatat
ccattccaaacggggctgttcagacagcagactgaaaagggtgaagccattgtacaggaa
gcaatggagcaaacaggagtggccgattttgcgcaaaagccgattcgcgaactaagcgga
ggggaacagcagcgggtgtatttggcacaagctttggcgcagcagccgcgtattttattt
ttggacgagccgactaattttctcgatctggcttatcaaaaagacctgcttgatctgatc
aaacgcctgacgagagaaagcggattggcagctgtcagcgtttttcatgatctgaacacc
gcaagcctgtactgtgatgggctcatgtttatgaaaaacggtaccgccgggcctaagcaa
aaaccggaatatgctgttacagaacaaagcataaaggcggtgtacgatacagatgtcacc
gccttggttcatcaaagctcacctaaaccgatgattgtgattcagcctgaaaaagatagc
gtgaagcggcagtctatcccatttgaagcattgctccaagcggggcgtgatgacattctt
ctgcaaacggaaatcccgcttcgaacattgtcctccacgcctatcggtgcagggttttcg
tggagcaggacgctgatccataaacggctgccagatcagccagatccgatagaaggactt
acggcctgtctttcagaaagcggttttcaactgcaggagacgtgtgcgatggcttcttca
gaaagacttgaccgtttcgtgtatcgaacatatgaagacggagagttatccgttttcata
tgcgttcagaccggcttttcgatttggattttgattaacggctatgcggcagatcaattc
ttcatcaaagctcttatggctgccgaagcagaacggacgaaagtgctgggagacggagga
ggcacaggtgatattctcatcgccgcgactcaaactcagcaatcagaaaacatagaacag
cggctgaaccaattgataaagaaagggacagctgaatgtataaaagaggctgctgagttg
tttgaataa

DBGET integrated database retrieval system