KEGG   Bacillus subtilis subsp. subtilis 168: BSU33160Help
Entry
BSU33160          CDS       T00010                                 

Gene name
yvrA
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33160 (yvrA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33160 (yvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_23 CbiZ AAA_22 SbcCD_C AAA_14 AAA_29 AAA_5 AAA_30 AAA_15 Csm1_B NACHT T2SSE MobB
Motif
Other DBs
NCBI-GeneID: 935968
NCBI-ProteinID: NP_391196
Pasteur: BG14141
BSORF: BG14141
UniProt: O34631
Position
complement(3401141..3402469)
Genome map
AA seq 442 aa AA seqDB search
MKAEGLSGGYGDSRLINNVSLTVEKGEFLGILGPNGSGKTTLLHLLTGTLPAKKGRVYLA
GKLLADYKPKELAQIMAVLPQKMDQAFTFTVEETVAFGRYPFQTGLFRQQTEKGEAIVQE
AMEQTGVADFAQKPIRELSGGEQQRVYLAQALAQQPRILFLDEPTNFLDLAYQKDLLDLI
KRLTRESGLAAVSVFHDLNTASLYCDGLMFMKNGTAGPKQKPEYAVTEQSIKAVYDTDVT
ALVHQSSPKPMIVIQPEKDSVKRQSIPFEALLQAGRDDILLQTEIPLRTLSSTPIGAGFS
WSRTLIHKRLPDQPDPIEGLTACLSESGFQLQETCAMASSERLDRFVYRTYEDGELSVFI
CVQTGFSIWILINGYAADQFFIKALMAAEAERTKVLGDGGGTGDILIAATQTQQSENIEQ
RLNQLIKKGTAECIKEAAELFE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagaagggctgtcgggaggatacggcgacagccgcctaatcaacaatgtcagc
ttaacagtggagaagggagaatttcttggaattctcggccctaatggaagcggaaaaacc
acgcttttgcacttgctgacaggtacgctgccggccaagaaaggcagggtttatctggcc
ggaaaactgctggcggactataaaccgaaggaactggcgcaaatcatggctgtcctgccg
caaaaaatggatcaagccttcacctttactgtcgaagaaactgtagcctttggcagatat
ccattccaaacggggctgttcagacagcagactgaaaagggtgaagccattgtacaggaa
gcaatggagcaaacaggagtggccgattttgcgcaaaagccgattcgcgaactaagcgga
ggggaacagcagcgggtgtatttggcacaagctttggcgcagcagccgcgtattttattt
ttggacgagccgactaattttctcgatctggcttatcaaaaagacctgcttgatctgatc
aaacgcctgacgagagaaagcggattggcagctgtcagcgtttttcatgatctgaacacc
gcaagcctgtactgtgatgggctcatgtttatgaaaaacggtaccgccgggcctaagcaa
aaaccggaatatgctgttacagaacaaagcataaaggcggtgtacgatacagatgtcacc
gccttggttcatcaaagctcacctaaaccgatgattgtgattcagcctgaaaaagatagc
gtgaagcggcagtctatcccatttgaagcattgctccaagcggggcgtgatgacattctt
ctgcaaacggaaatcccgcttcgaacattgtcctccacgcctatcggtgcagggttttcg
tggagcaggacgctgatccataaacggctgccagatcagccagatccgatagaaggactt
acggcctgtctttcagaaagcggttttcaactgcaggagacgtgtgcgatggcttcttca
gaaagacttgaccgtttcgtgtatcgaacatatgaagacggagagttatccgttttcata
tgcgttcagaccggcttttcgatttggattttgattaacggctatgcggcagatcaattc
ttcatcaaagctcttatggctgccgaagcagaacggacgaaagtgctgggagacggagga
ggcacaggtgatattctcatcgccgcgactcaaactcagcaatcagaaaacatagaacag
cggctgaaccaattgataaagaaagggacagctgaatgtataaaagaggctgctgagttg
tttgaataa

DBGET integrated database retrieval system