KEGG   Bacillus subtilis subsp. subtilis 168: BSU33170Help
Entry
BSU33170          CDS       T00010                                 

Gene name
yvrB
Definition
(RefSeq) ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33170 (yvrB)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33170 (yvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-GeneID: 938583
NCBI-ProteinID: NP_391197
Pasteur: BG14142
BSORF: BG14142
UniProt: O34451
Position
complement(3402469..3403530)
Genome map
AA seq 353 aa AA seqDB search
MRKAFTRIRLRNNRYAAYIIGFSFLAVSIILGISCGSLHIPIPAVFRVFWHQGFGGSIGS
DDPMYTNIMMNIRLPRVVLAALVGAALSIAGAAFQGLLKNPLADPYTLGVSSGASVGAVV
TLFLGLHLPVIGGFTLPVLSVAAALATMAAVLFFSRLVHASMSVSTLILTGVITNSFLGA
FISLIIALTGDNLLPIVHWLLGSVSMRGWSYVILFLPFFLLGTILLIINGRELNVMTYGE
DKAKLLGVSVQQRKMMILIAGSLLTGSAVAVSGTIGFVGLVIPHITRLLWGTDHRHLLPL
SALLGAGFLVLADLLSRTIIEPIELPIGIITSLAGAPVFALILIRQHRGGRSL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgcggaaagcatttacccggatacgtttaaggaataatcgttatgccgcatatatcatt
ggtttctcatttttagccgtgagcatcatcttaggaatttcttgcggcagcctgcatatt
cctattcccgctgtttttcgtgtcttttggcatcaaggtttcggcggctctatcggttct
gatgatccgatgtacactaatattatgatgaatatcagactgccgagagttgtgctggcc
gcccttgtgggggcggctctttctattgcaggggccgcttttcaaggattgttgaaaaat
ccgcttgctgatccctatacgctaggtgtgtcatccggtgcttcagtcggagctgttgtg
actctgttcttaggtttgcaccttcctgtcatcggagggtttacactcccggttttgagt
gtagccgcggcactggccacgatggcggcggtccttttcttcagccgcctcgttcatgct
tcgatgtctgtttccaccctcattttgaccggtgtcatcaccaactcttttttaggcgca
tttatttctcttatcatcgccttgacaggagacaacctgcttccgattgtgcattggctg
cttggcagcgtctcaatgaggggctggagctatgttattttgtttctcccgttttttctt
ttgggaaccattttattgattataaacggaagggaactgaacgtgatgacatatggagaa
gataaagcaaagcttcttggagtcagcgttcagcagaggaagatgatgattttaatagcc
ggatctcttttgacgggaagcgctgtggcagtatcgggtacgattggctttgtcggcctt
gtgattccgcatatcacaaggcttttgtggggaacggaccatcggcatttactgccgttg
tccgccttgcttggggcagggtttcttgttttagccgatctgctttccagaaccatcatt
gagccgattgaactgccgatcgggatcattacgtccttggcgggagcgcctgtgttcgct
cttattttaattcggcagcatcgcggggggagaagcttatga

DBGET integrated database retrieval system