KEGG   Bacillus subtilis subsp. subtilis 168: BSU33180Help
Entry
BSU33180          CDS       T00010                                 

Gene name
yvrC
Definition
(RefSeq) ABC transporter substrate-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33180 (yvrC)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33180 (yvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DUF3837 Peripla_BP_4 Elf4 Pro_dh LPAM_2
Motif
Other DBs
NCBI-GeneID: 935980
NCBI-ProteinID: NP_391198
Pasteur: BG14143
BSORF: BG14143
UniProt: O34805
Position
complement(3403493..3404437)
Genome map
AA seq 314 aa AA seqDB search
MKKRAGIWAALLLAAVMLAGCGNPADQKDSKAKQKTEVFPVTIDDASNQDVTIKKEPKKI
VSLMPSNTEITYALGLGDKVVGVTTNDTYPKEVKKVEKVGDMNVNVEKVISLKPDLVLAH
ESSMSASADAIKQLKDAGITVLTVNDAQSFSEVYKSIEMIGEAGGAEKKADQLVKSMKSD
LKDIQEKAKTISKDEEKSVFIEVSPDPDIYTTGKDTFMNEMLNVIHAKNAAADQTGWVQM
TDEAIVKLNPDAIVTTDGVKAKAVEKRDGWSEINAVKHHRVYDVDPDLVTRSGPRLIEGV
EELAESIYPDTFKE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgagccgggatatgggctgcgcttctgttggctgctgttatgctggcaggc
tgcggcaatcctgcggatcagaaggattcaaaggcaaaacaaaaaacagaagtgttccct
gtcaccattgatgatgcgtcaaaccaagatgtaaccatcaaaaaagagccaaaaaagatt
gtttcattaatgccgagcaacacagaaattacatacgcactcggccttggtgacaaagtg
gtcggtgtcaccacaaacgatacctatccaaaggaagtcaaaaaggttgagaaagtcgga
gatatgaatgtaaacgttgaaaaagtcatttctctaaaaccagatctcgttctggcccat
gagtcttccatgtcagcatcagcggatgccatcaaacagctgaaggacgcgggcattaca
gtgctgactgtcaatgatgcacaatcattctccgaggtgtacaaatcaatcgaaatgatc
ggagaagctggcggggcggagaaaaaagccgatcagctcgtgaaaagcatgaaatcagat
ctaaaggatattcaagaaaaagcgaaaaccatttcaaaagacgaggagaaaagcgtattt
atcgaggtttctcctgatcctgacatttatacaaccggaaaagatacgtttatgaatgaa
atgctaaatgtcatccatgctaaaaacgcagctgcggatcagacaggatgggtgcaaatg
acagacgaggcgatcgtaaaactcaatcctgatgcaattgttacaacggacggtgtgaaa
gcgaaagctgtggaaaaacgcgatggctggagcgaaatcaatgctgtgaaacatcatcgt
gtatatgatgtggaccctgatcttgtgacacgttccggtccccgtctgatcgaaggggtc
gaagaacttgcggaaagcatttacccggatacgtttaaggaataa

DBGET integrated database retrieval system