KEGG   Bacillus subtilis subsp. subtilis 168: BSU33190Help
Entry
BSU33190          CDS       T00010                                 

Gene name
yvrD
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase TrbI
Motif
Other DBs
NCBI-GeneID: 938584
NCBI-ProteinID: NP_391199
Pasteur: BG14144
BSORF: BG14144
UniProt: O34782
Position
3404835..3405626
Genome map
AA seq 263 aa AA seqDB search
MDLQLKEKLVLITGSTSGIGKAAAKSFLQEGAAVIVNGRKQETVDRTIEELSGYGTVHGA
AADLSKTDEAAAFIEKVNEIGDIDILVNNLGFFEVKDFADVTDEEWNQYFEVNVMSAVRT
SRHFLPKMLAKNSGRILNIASEAGVKPLPTMIPYSMTKTALISLSRGMAEMTKGTNVTVN
SVLPGPTWTEGVASYMEGAAQAAGQDTDTFIKDYFKVNEPTSLIQRYATAEEVANTIVFL
ASDAASAINGTAQRVEGGIIRSL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggatttacagctaaaagaaaaactcgtcttaatcaccggctcgacgtccggtatcggg
aaagccgccgcaaaaagctttctgcaagagggtgcggcagtcattgtcaacggacgcaaa
caggagactgtcgatcgcaccattgaagagctttctggctatggaacagtgcacggtgct
gctgccgatttgtcaaaaacagatgaagcagcggcttttatcgaaaaagtaaatgaaatc
ggtgatatcgatatccttgtcaacaaccttggtttcttcgaggtaaaagacttcgccgat
gtgacagatgaagagtggaatcaatatttcgaagtgaacgtgatgagcgccgttcggaca
agccgtcacttccttccaaaaatgcttgccaaaaacagcggccgcattttaaatattgca
agtgaagcaggcgtcaaaccgctgccaacgatgattccatactcaatgacaaaaacggca
ctgatcagcctttcaagaggaatggctgaaatgacaaaaggcacaaatgtgacggtcaac
tcagtgctcccgggacctacttggacagagggcgtggcctcctatatggaaggcgccgca
caagcagccggacaggatacagatacatttatcaaagactatttcaaggtcaatgagcca
acctcacttattcagcgatacgcgacagcagaagaagtcgccaacacaatcgtattcctc
gcgtctgacgccgcatccgccattaacggcacggcacagcgtgtggaaggcggcattatc
cgttctctgtag

DBGET integrated database retrieval system