KEGG   Bacillus subtilis subsp. subtilis 168: BSU33200Help
Entry
BSU33200          CDS       T00010                                 

Gene name
yvrE
Definition
(RefSeq) sugar lactone lactonase YvrE
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU33200 (yvrE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     BSU33200 (yvrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Reg_prop DUF4585
Motif
Other DBs
NCBI-GeneID: 935979
NCBI-ProteinID: NP_391200
Pasteur: BG14145
BSORF: BG14145
UniProt: O34940
Position
complement(3405664..3406542)
Genome map
AA seq 292 aa AA seqDB search
MDAVLEADTRAVIGEGPLWDEENGRLYWVDILGSELHIFDPEEKINRSIKFKSFVTALAK
YSKDELIMTMKDGFYLYHLRDDSLEKIKQPKDMHESLRFNDAKCDPYGRLWAGTTSMEGE
QKQASLYRLNLDGSLVKIKDQVSTSNGLDWDRERNLMYYIDTPTQEIVRYSYDPQSGDVS
NPEPVYRFDQSDGLPDGMTIDQNGMLWVALFGGSRVVHIDPFQKKEINSISVPAKYVTCC
AFGGRDLKTLYITTATEQMTEKERYEQPHAGGLFSAQLETGGYQPVPFAGDV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagtattggaagcagacactcgggcagtgattggtgaaggcccgttatgggat
gaagagaacggccgcttatattgggttgatatcctggggagcgagctccacatctttgac
cctgaagaaaaaatcaaccgatcaatcaaattcaaatcctttgtgacggcgcttgcgaaa
tattcaaaggatgaactgattatgacgatgaaggacgggttttacctgtatcatcttcgg
gatgacagcttggaaaaaattaaacagccgaaggacatgcatgagagcctgagatttaat
gatgctaaatgtgacccgtacggaaggctttgggcggggacgacgagcatggaaggcgag
caaaaacaggcgtcgctgtaccgtttgaatctagacggcagtcttgtcaaaatcaaggat
caagtctccacctcaaacggtttggattgggaccgcgagcggaatttgatgtattacatc
gacacgccgacccaggagattgtacgttacagctatgatcctcaaagcggagatgtttcg
aatccagaacctgtctatcgttttgatcagtcagacggattgccggacggcatgacaatt
gaccaaaatggcatgctgtgggtggcgctgtttggcggcagccgcgttgttcacattgac
ccgtttcagaaaaaagaaatcaattcaatcagcgtgccggctaaatatgtcacgtgctgc
gcgttcggcggcagagacttaaaaaccctttacattacaacggcaacagaacaaatgaca
gaaaaagagagatacgagcagcctcacgctggagggttgttttcagcacaactggaaaca
ggcggatatcagccggtaccatttgctggagacgtataa

DBGET integrated database retrieval system