KEGG   Bacillus subtilis subsp. subtilis 168: BSU33210Help
Entry
BSU33210          CDS       T00010                                 

Gene name
yvrG
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HATPase_c_2 HATPase_c_5 DUF4636 DUF2070 ArlS_N
Motif
Other DBs
NCBI-GeneID: 935985
NCBI-ProteinID: NP_391201
Pasteur: BG14146
BSORF: BG14146
UniProt: O34989
Position
complement(3406614..3408356)
Genome map
AA seq 580 aa AA seqDB search
MRLRWKFLFHFFGQMLIVILLLTVMLVASFFYLDARFSDAESNSGLTKATTDTLEAYLDV
NEDGTWEVDNFLKKSVDKQHGWMQIIDSEGNTDYSYGVPKDVPGTYTKKELLSIYKTKKL
HNYKLNYWAINIEDKSYLLLSGWKSKSEQLLTSVEKREQKIDSLAHYKSSTIDYIKRKKG
AIYLLDSNGKILDSINSTKSERKTMNQLELLKYSSKPWNYKREISVKILNKDRWMVATVP
NPVYVTDQEFNKSFLKVVLKAMFLVMAVLFMYIIWMTVWYMFRFGLPIFHTIRWLVNLSK
GKLEEPRNREGRPVSKNKKGKIKQPYRFFGEIFESMDQLTETLRRDKRNREKIQATREEW
IAGLSHDLKTPLSSIYGYSMMLESKQYDWSPEEVKEMGQVVREKSEYMSKLIEDLNLTYR
LKNDALPIERKLTSLIPFFKNVIEDFKKNPFSEGYDISFVSKEEHIEFALDEAWFRRILE
NLLGNAVKHNGKGTEIQVILEQTKNHISLKVKDNGKGMDEETITHLFNRYYRGTNTKDST
AGTGLGLAIAKELVHLHNGTIHVNSRTNIGTVITILFKKQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaagatggaagtttttgtttcactttttcggccagatgctgattgtgatcctg
ctgcttacggttatgcttgttgcatcgtttttctatttagacgcccgttttagcgatgcg
gaatccaattcagggctgacgaaagcaacgaccgacacacttgaggcatatctcgatgta
aacgaagacgggacatgggaagtggataatttcctgaagaaatctgttgataaacagcac
ggctggatgcaaatcattgattcggaaggaaacactgattattcctacggcgtgccaaaa
gacgtgccgggcacctataccaagaaagagcttttgtctatttataaaaccaaaaagctt
cataactataaactgaattattgggccatcaatattgaagataagtcgtatcttctattg
tccggctggaaatcaaaaagtgaacagctcctgacttccgttgaaaagcgtgaacaaaag
atagactcactagcgcactataagtctagtaccatcgactatattaaacggaaaaaaggc
gccatttacctgttagacagcaatggaaagattctcgacagcatcaacagcacaaaaagc
gagagaaaaacgatgaaccagctggagctgcttaaatacagctctaagccttggaactat
aagcgggaaatttccgttaagatcctcaataaagacagatggatggtcgctacggtgccg
aacccagtctatgtaaccgatcaggagtttaacaaatcattcctgaaggttgtattaaaa
gcgatgtttctcgtgatggccgttttgttcatgtatatcatttggatgaccgtttggtat
atgttccgattcgggctgccgatttttcacacgattagatggctggtcaatctgtcaaaa
gggaagcttgaggagcccagaaaccgggaaggccgtcctgtcagcaaaaataaaaaggga
aaaatcaaacagccgtaccgcttcttcggtgagatatttgaatcaatggatcagctgact
gaaacgctgagaagggataaaagaaacagagaaaaaatccaggcgacaagggaagaatgg
attgccggtttgtcacatgacttaaaaacaccgctcagcagcatttacggctacagcatg
atgctcgagtcgaagcagtatgactggtcgccggaagaagtgaaagaaatggggcaggtt
gtcagagaaaaatctgaatacatgtctaagctgattgaagacttaaatttaacgtatcgc
ctgaaaaatgatgctcttcctattgagagaaagctcactagccttatcccgttttttaaa
aatgtcattgaggattttaagaaaaatccgttttctgaaggctatgatatctcgtttgta
tccaaagaagagcatattgaatttgcccttgatgaagcgtggttcaggcgcatattagaa
aacctccttgggaatgccgtgaagcacaacggcaaaggaacagagattcaagtcattctg
gagcaaacaaaaaatcatatttctttaaaagtgaaggacaatgggaaaggaatggatgaa
gaaacgatcacccatttgtttaaccgctactacagagggacgaacacaaaagattcaact
gccggaacgggtctcgggctcgcgattgccaaggagcttgtccatctgcataacggaacg
atccatgtgaacagcagaacgaacattggaacggtcattaccatcctttttaaaaaacaa
taa

DBGET integrated database retrieval system