KEGG   Bacillus subtilis subsp. subtilis 168: BSU33221Help
Entry
BSU33221          CDS       T00010                                 

Gene name
yvrH
Definition
(RefSeq) transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF3369
Motif
Other DBs
NCBI-GeneID: 935974
NCBI-ProteinID: NP_391202
UniProt: P94504
Position
complement(3408353..3409066)
Genome map
AA seq 237 aa AA seqDB search
MENASILIVDDEKAIVDMIKRVLEKEGYRNILDAASAEEAIPVVKANKVDLIVLDVMMGG
MSGFEACTLIREYSDAPIFFLTARSSDADKLSGFAVGADDYITKPFNPLELAARIRAHLK
RTYQSKETSSNQTYTYDYFTFSPQNAELIVGGEAVACSAQLLQLLQYFCEHPNVVLSKDQ
IYEKVWGYPSYGDNNTVMVHIRKLREKIERDPSNPEYIVTVRGLGYRFIPNPEGKRS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatgcgtcaattttaatcgtagacgatgagaaagcgattgtggacatgatcaaa
cgcgttctcgaaaaagaaggttatcgaaatatactggatgcggcaagcgcagaagaagcg
attcccgttgtgaaggccaataaggttgacttgattgtgctggatgtcatgatgggcgga
atgtccggttttgaagcctgcacattgatcagagagtattcagacgctccgatttttttc
ctgacggcaagatcatccgacgcggacaaattatcgggctttgcggttggagctgatgac
tatatcacaaaaccatttaatccgctggaattagcggcgcggatcagagcgcatctcaag
cgtacatatcaatcgaaagaaacgagttcaaatcaaacctacacatatgattactttact
ttttctccgcaaaatgccgagttgatcgtaggcggggaagccgttgcctgttcagcccag
cttctgcagcttttgcagtatttttgtgaacaccctaacgtggtgctttccaaagatcaa
atatatgaaaaagtatggggctatccttcctacggtgacaacaacaccgtcatggttcat
attcgcaagcttagggagaagattgagcgcgatccgagcaatccggagtatattgtaacc
gttcgaggtctcggctatcgttttatcccaaatcctgaaggcaagcggtcatga

DBGET integrated database retrieval system