KEGG   Bacillus subtilis subsp. subtilis 168: BSU33222Help
Entry
BSU33222          CDS       T00010                                 

Gene name
rsoA
Definition
(RefSeq) sigma-O factor regulatory protein RsoA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_16
Motif
Other DBs
NCBI-GeneID: 8302938
NCBI-ProteinID: YP_003097787
UniProt: C0H3R4
Position
complement(3409219..3409458)
Genome map
AA seq 79 aa AA seqDB search
MDGQFEQKKKQKDETYDIEHLIACFSPMIRKKLSNTSYQEREDLEQELKIKMFEKADMLL
CQDVPGFWEFILYMVDENS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
gtggacggccagtttgaacaaaaaaagaaacaaaaagacgagacttatgacattgagcac
ctgattgcatgcttttcaccgatgatcagaaaaaaactcagcaatacgtcctatcaagaa
agagaagatttagagcaagagctgaagatcaaaatgtttgaaaaggctgatatgctttta
tgtcaggatgtaccggggttttgggagtttattttgtacatggtagatgagaactcataa

DBGET integrated database retrieval system