KEGG   Bacillus subtilis subsp. subtilis 168: BSU33230Help
Entry
BSU33230          CDS       T00010                                 

Gene name
sigO
Definition
(RefSeq) RNA polymerase sigma factor SigO
  KO
K03093  RNA polymerase sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU33230 (sigO)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU33230 (sigO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r4_2 UPF0122 KORA GerE DNA_Packaging_2 HTH_38 Sigma70_ECF DUF1492 MarR_2
Motif
Other DBs
NCBI-GeneID: 935983
NCBI-ProteinID: NP_391203
Pasteur: BG14147
BSORF: BG14147
UniProt: O34843
Position
complement(3409462..3409992)
Genome map
AA seq 176 aa AA seqDB search
MKHPIVKHFLSNPQHYRLFKNVMESPNEKDARSLDELFKQFYKEIRIVKYMNSMIRIFSI
DFDKRVRKNQKRYPLTVDHPEAGDRLSSETGSDAFEEFLDRQDDLSQHVQDYQLYQAIQK
LTDKQKSVLTKVYLHGATMQEIADSLGESRQNISNIHKKGLENIRKQLAAQKKGEK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatcccatcgtgaagcattttttgagcaatcctcagcattaccgtttgttcaaa
aacgtaatggaaagccctaacgaaaaagatgcaagatcattggacgagctatttaagcaa
ttttataaagaaatccgcatcgtcaagtatatgaattcaatgattcgcatcttttctatt
gattttgataagcgggttcgcaaaaaccaaaaacggtatccactgacggttgatcatccg
gaggcgggagatcggctttcttccgaaacaggtagcgatgcatttgaagaatttttagac
aggcaggatgatttgagccagcatgtacaggattaccagctctaccaagcgatccagaag
ctgactgacaaacaaaaaagtgtgctgacgaaagtctatcttcacggtgccacgatgcag
gagattgcagattcattaggggagtcccgacaaaacatctccaacattcataaaaagggg
ctggagaatatcagaaagcagttagcggcgcaaaaaaagggggaaaagtaa

DBGET integrated database retrieval system