KEGG   Bacillus subtilis subsp. subtilis 168: BSU33240Help
Entry
BSU33240          CDS       T00010                                 

Gene name
oxdC
Definition
(RefSeq) oxalate decarboxylase OxdC
  KO
K01569  oxalate decarboxylase [EC:4.1.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU33240 (oxdC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.2  oxalate decarboxylase
     BSU33240 (oxdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_1 Cupin_2 Cupin_3 MannoseP_isomer AraC_binding GPI ARD Cupin_4
Motif
Other DBs
NCBI-GeneID: 938620
NCBI-ProteinID: NP_391204
Pasteur: BG14148
BSORF: BG14148
UniProt: O34714
Structure
PDB: 

Position
3410466..3411623
Genome map
AA seq 385 aa AA seqDB search
MKKQNDIPQPIRGDKGATVKIPRNIERDRQNPDMLVPPETDHGTVSNMKFSFSDTHNRLE
KGGYAREVTVRELPISENLASVNMRLKPGAIRELHWHKEAEWAYMIYGSARVTIVDEKGR
SFIDDVGEGDLWYFPSGLPHSIQALEEGAEFLLVFDDGSFSENSTFQLTDWLAHTPKEVI
AANFGVTKEEISNLPGKEKYIFENQLPGSLKDDIVEGPNGEVPYPFTYRLLEQEPIESEG
GKVYIADSTNFKVSKTIASALVTVEPGAMRELHWHPNTHEWQYYISGKARMTVFASDGHA
RTFNYQAGDVGYVPFAMGHYVENIGDEPLVFLEIFKDDHYADVSLNQWLAMLPETFVQAH
LDLGKDFTDVLSKEKHPVVKKKCSK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaaatgacattccgcagccaattagaggagacaaaggagcaacggtaaaa
atcccgcgcaatattgaaagagaccggcaaaaccctgatatgctcgttccgcctgaaacc
gatcatggcaccgtcagcaatatgaagttttcattctctgatactcataaccgattagaa
aaaggcggatatgcccgggaagtgacagtacgtgaattgccgatttcagaaaaccttgca
tccgtaaatatgcggctgaagccaggcgcgattcgcgagcttcactggcataaagaagct
gaatgggcttatatgatttacggaagtgcaagagtcacaattgtagatgaaaaagggcgc
agctttattgacgatgtaggtgaaggagacctttggtacttcccgtcaggcctgccgcac
tccatccaagcgctggaggagggagctgagttcctgctcgtgtttgacgatggatcattc
tctgaaaacagcacgttccagctgacagattggctggcccacactccaaaagaagtcatt
gctgcgaacttcggcgtgacaaaagaagagatttccaatttgcctggcaaagaaaaatat
atatttgaaaaccaacttcctggcagtttaaaagatgatattgtggaagggccgaatggc
gaagtgccttatccatttacttaccgccttcttgaacaagagccgatcgaatctgaggga
ggaaaagtatacattgcagattcgacaaacttcaaagtgtctaaaaccatcgcatcagcg
ctcgtaacagtagaacccggcgccatgagagaactgcactggcacccgaatacccacgaa
tggcaatactacatctccggtaaagctagaatgaccgtttttgcatctgacggccatgcc
agaacgtttaattaccaagccggtgatgtcggatatgtaccatttgcaatgggtcattac
gttgaaaacatcggggatgaaccgcttgtctttttagaaatcttcaaagacgaccattat
gctgatgtatctttaaaccaatggcttgccatgcttcctgaaacatttgttcaagcgcac
cttgacttgggcaaagactttactgatgtgctttcaaaagaaaagcacccagtagtgaaa
aagaaatgcagtaaataa

DBGET integrated database retrieval system