KEGG   Bacillus subtilis subsp. subtilis 168: BSU33250Help
Entry
BSU33250          CDS       T00010                                 

Gene name
yvrL
Definition
(RefSeq) membrane-bound negative regulator YvrL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YrvL Phage_holin_4_2 Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 935982
NCBI-ProteinID: NP_391205
Pasteur: BG14149
BSORF: BG14149
UniProt: O34686
Position
3411684..3412094
Genome map
AA seq 136 aa AA seqDB search
MKHQNPSKRLLRLSIKYLLAAAAVVLTYFAVIYILFSLAGTSYRSAAHVLLFAVVFLVLG
LCFEPFERLMIHSFTFFKTGKRLFILLAGIVQLLFLWMTAHTTDQLISDIWLSTTEEMIV
AAVFLILDKCNSALPS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatcaaaacccttcaaaacgcttattgcggctctccataaagtacttgctggcc
gcagcagcagtggtgttgacctattttgctgtcatctatatattgttttctttagcggga
acgagctaccgctcagcagctcatgtcctgctttttgccgtggtattccttgttctcgga
ttatgctttgaaccatttgaacggctgatgatacatagctttacatttttcaagacagga
aaacgtctattcattctccttgctggcatcgtacagctgctgtttttgtggatgactgct
catacaacagaccaattgatcagcgacatctggctgtccaccacagaagaaatgattgtc
gcagccgtttttttgattttagacaaatgcaactcggctcttcccagctaa

DBGET integrated database retrieval system