KEGG   Bacillus subtilis subsp. subtilis 168: BSU33260
Entry
BSU33260          CDS       T00010                                 

Symbol
yvrN
Name
(RefSeq) ABC transporter permease
  KO
K24948  antimicrobial peptide resistance transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33260 (yvrN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Antimicrobial peptide resistance transporter
    BSU33260 (yvrN)
SSDB
Motif
Pfam: MacB_PCD FtsX DASH_Dam1 DUF3879
Other DBs
NCBI-GeneID: 937213
NCBI-ProteinID: NP_391207
Pasteur: BG11368
BSORF: BG11368
UniProt: P46324 A0A6M3ZG83
Position
complement(3412128..3413357)
AA seq 409 aa
MLEHIRISFQSIFSHKLRSILTMLGVIIGIAAIIAIVSMLKGQSEQLKQSMIGMGNNAIN
VVYQPSGGEEESGGPQVSYASAPPVAEETVKAIKSDPMVKGLSLYYLSEGASVFHLTNVS
YPQVYGVDDDYFDMFPIRITEGRKLTENDLNSTHQVVMINEAVRDELFPDGEALHKSIEM
NGVPFKVVGVFKEKNQQESMFEGDYANPVLYVPKKVWPLIEGFDAPTQIAVQADSSEHIQ
EAGVMAADLLNQGLSEAELEKAEYSVMDLQEIAQEVESFNQSFALLLGGIASISLLVGGI
GVMNIMLVSVTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGILGVLAGFGIAKLL
TVIFPMPFIVSIPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALRYE
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcttgaacatattcgaatctcctttcaatccattttctctcataaattaagatcgatt
ctgacaatgcttggcgtcattatcggcatagcggcaatcatcgcgattgtttcaatgctg
aagggccaaagtgagcagttaaagcaaagtatgatcggcatgggaaacaacgccatcaat
gttgtctaccagccgtctggcggagaagaggagagcggcggccctcaggtgtcgtatgcg
tccgcgccgcctgtagcggaagaaacagtaaaggcgatcaaatcagatccgatggtcaaa
ggattatccttatattacttgtcagaaggcgcgagcgtttttcatttaactaacgtttcg
tatccccaagtgtatggagtggacgatgattacttcgacatgtttccaatccgaataacc
gaagggagaaagctgacggaaaacgatttaaacagcacacaccaagtagtgatgatcaat
gaagctgtcagagatgaactgtttccagacggagaagctctgcataaaagcattgagatg
aatggtgtgccgtttaaggtcgtgggtgtttttaaagaaaaaaatcaacaggaaagcatg
tttgaaggcgactatgcgaacccggttttgtacgtgccgaaaaaagtgtggccgcttatt
gaaggatttgacgcgccaacgcagattgccgtgcaggctgattcttctgagcatatccaa
gaagcgggtgtaatggctgcagatcttttaaatcagggactgtcagaagctgagctggaa
aaagcagagtacagtgtaatggatcttcaggagatcgcgcaggaagtggagtcctttaat
cagtcatttgcattgctgcttggcggtatcgccagtatttcacttttggtgggcggtatc
ggcgtcatgaacattatgctcgtttccgtaacggagcgcacgagggaaatcggaattaag
aaagcgctcggtgctaagcggcgtgtgattttatttcaatttttaaccgaggctgtcgtg
ctgacaagcattggcggaatactcggtgtgctggcgggcttcggcatcgccaagctgctg
acggtcatttttccgatgccttttatcgtctccattccagctgttgtcggagcactcatc
ttttcaatggcagtcggcattatcttcggcttgcttccgtctatcaaggcttcgaagctt
cagcctgtagacgcgcttcgctatgaataa

DBGET integrated database retrieval system