KEGG   Bacillus subtilis subsp. subtilis 168: BSU33260Help
Entry
BSU33260          CDS       T00010                                 

Gene name
yvrN
Definition
(RefSeq) ABC transporter permease
  KO
K02004  putative ABC transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33260 (yvrN)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BSU33260 (yvrN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD FtsX DASH_Dam1 DUF3879
Motif
Other DBs
NCBI-GeneID: 937213
NCBI-ProteinID: NP_391207
Pasteur: BG11368
BSORF: BG11368
UniProt: P46324
Position
complement(3412128..3413357)
Genome map
AA seq 409 aa AA seqDB search
MLEHIRISFQSIFSHKLRSILTMLGVIIGIAAIIAIVSMLKGQSEQLKQSMIGMGNNAIN
VVYQPSGGEEESGGPQVSYASAPPVAEETVKAIKSDPMVKGLSLYYLSEGASVFHLTNVS
YPQVYGVDDDYFDMFPIRITEGRKLTENDLNSTHQVVMINEAVRDELFPDGEALHKSIEM
NGVPFKVVGVFKEKNQQESMFEGDYANPVLYVPKKVWPLIEGFDAPTQIAVQADSSEHIQ
EAGVMAADLLNQGLSEAELEKAEYSVMDLQEIAQEVESFNQSFALLLGGIASISLLVGGI
GVMNIMLVSVTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGILGVLAGFGIAKLL
TVIFPMPFIVSIPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALRYE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacatattcgaatctcctttcaatccattttctctcataaattaagatcgatt
ctgacaatgcttggcgtcattatcggcatagcggcaatcatcgcgattgtttcaatgctg
aagggccaaagtgagcagttaaagcaaagtatgatcggcatgggaaacaacgccatcaat
gttgtctaccagccgtctggcggagaagaggagagcggcggccctcaggtgtcgtatgcg
tccgcgccgcctgtagcggaagaaacagtaaaggcgatcaaatcagatccgatggtcaaa
ggattatccttatattacttgtcagaaggcgcgagcgtttttcatttaactaacgtttcg
tatccccaagtgtatggagtggacgatgattacttcgacatgtttccaatccgaataacc
gaagggagaaagctgacggaaaacgatttaaacagcacacaccaagtagtgatgatcaat
gaagctgtcagagatgaactgtttccagacggagaagctctgcataaaagcattgagatg
aatggtgtgccgtttaaggtcgtgggtgtttttaaagaaaaaaatcaacaggaaagcatg
tttgaaggcgactatgcgaacccggttttgtacgtgccgaaaaaagtgtggccgcttatt
gaaggatttgacgcgccaacgcagattgccgtgcaggctgattcttctgagcatatccaa
gaagcgggtgtaatggctgcagatcttttaaatcagggactgtcagaagctgagctggaa
aaagcagagtacagtgtaatggatcttcaggagatcgcgcaggaagtggagtcctttaat
cagtcatttgcattgctgcttggcggtatcgccagtatttcacttttggtgggcggtatc
ggcgtcatgaacattatgctcgtttccgtaacggagcgcacgagggaaatcggaattaag
aaagcgctcggtgctaagcggcgtgtgattttatttcaatttttaaccgaggctgtcgtg
ctgacaagcattggcggaatactcggtgtgctggcgggcttcggcatcgccaagctgctg
acggtcatttttccgatgccttttatcgtctccattccagctgttgtcggagcactcatc
ttttcaatggcagtcggcattatcttcggcttgcttccgtctatcaaggcttcgaagctt
cagcctgtagacgcgcttcgctatgaataa

DBGET integrated database retrieval system