KEGG   Bacillus subtilis subsp. subtilis 168: BSU33270
Entry
BSU33270          CDS       T00010                                 

Symbol
yvrO
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K24949  antimicrobial peptide resistance transport system ATP-binding protein [EC:7.6.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33270 (yvrO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Antimicrobial peptide resistance transporter
    BSU33270 (yvrO)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 RsgA_GTPase AAA_22 AAA_16 AAA_23 AAA_30 DUF5906 ATPase_2 bpMoxR MMR_HSR1 AAA_25 RNA_helicase NB-ARC
Other DBs
NCBI-GeneID: 938472
NCBI-ProteinID: NP_391208
Pasteur: BG14151
BSORF: BG14151
UniProt: O34979 A0A6M3ZJB7
Position
complement(3413350..3414039)
AA seq 229 aa
MLTLNNISKSYKLGKEEVPILKHINLTVQAGEFLAIMGPSGSGKSTLMNIIGCLDRPTSG
TYTLDQIDILKGKDGALAEIRNESIGFVFQTFHLLPRLTALQNVELPMIYNKVKKKERRQ
RAYEALEKVGLKDRVSYKPPKLSGGQKQRVAIARALVNQPRFILADEPTGALDTKSSEQI
LALFSELHREGKTIIMITHDPDVAKKADRTVFIRDGELVLDERGDISHA
NT seq 690 nt   +upstreamnt  +downstreamnt
atgctgacactgaataatatttcgaagtcgtacaagctgggaaaagaagaagttccaatc
ttgaaacatatcaatctgaccgttcaggcgggggagtttttagctattatggggccttcc
ggttctggaaagtcaacgttaatgaatattatcggctgtttggacaggccaacctcagga
acctatacgcttgaccagatcgatatattgaaagggaaagacggggctttagccgaaatt
cgcaatgaatcaatcgggtttgtgtttcaaacttttcatttgctgccgcgtctcaccgcg
ctgcaaaatgtcgagctgccgatgatctacaataaagtgaagaaaaaagagagaaggcaa
cgggcatatgaagcgctggaaaaagtcggattaaaagacagggtctcctacaaaccgcct
aagctgtccggcggccaaaagcagcgggtggcgatagcgagggcccttgtcaatcagccg
aggtttattttagctgatgaaccgaccggggcgcttgataccaaatcaagtgaacaaatt
ttggcactgttttctgaactgcatcgggaaggcaagaccattattatgataacccacgac
ccggacgtcgccaaaaaagctgacagaaccgtttttatcagagacggagagttggtatta
gatgagagaggggatatcagccatgcttga

DBGET integrated database retrieval system