KEGG   Bacillus subtilis subsp. subtilis 168: BSU33270Help
Entry
BSU33270          CDS       T00010                                 

Gene name
yvrO
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33270 (yvrO)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BSU33270 (yvrO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 RsgA_GTPase AAA_22 AAA_16 AAA_23 AAA_30 T2SSE ATPase_2 MMR_HSR1 RNA_helicase AAA_25 NB-ARC
Motif
Other DBs
NCBI-GeneID: 938472
NCBI-ProteinID: NP_391208
Pasteur: BG14151
BSORF: BG14151
UniProt: O34979
Position
complement(3413350..3414039)
Genome map
AA seq 229 aa AA seqDB search
MLTLNNISKSYKLGKEEVPILKHINLTVQAGEFLAIMGPSGSGKSTLMNIIGCLDRPTSG
TYTLDQIDILKGKDGALAEIRNESIGFVFQTFHLLPRLTALQNVELPMIYNKVKKKERRQ
RAYEALEKVGLKDRVSYKPPKLSGGQKQRVAIARALVNQPRFILADEPTGALDTKSSEQI
LALFSELHREGKTIIMITHDPDVAKKADRTVFIRDGELVLDERGDISHA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactgaataatatttcgaagtcgtacaagctgggaaaagaagaagttccaatc
ttgaaacatatcaatctgaccgttcaggcgggggagtttttagctattatggggccttcc
ggttctggaaagtcaacgttaatgaatattatcggctgtttggacaggccaacctcagga
acctatacgcttgaccagatcgatatattgaaagggaaagacggggctttagccgaaatt
cgcaatgaatcaatcgggtttgtgtttcaaacttttcatttgctgccgcgtctcaccgcg
ctgcaaaatgtcgagctgccgatgatctacaataaagtgaagaaaaaagagagaaggcaa
cgggcatatgaagcgctggaaaaagtcggattaaaagacagggtctcctacaaaccgcct
aagctgtccggcggccaaaagcagcgggtggcgatagcgagggcccttgtcaatcagccg
aggtttattttagctgatgaaccgaccggggcgcttgataccaaatcaagtgaacaaatt
ttggcactgttttctgaactgcatcgggaaggcaagaccattattatgataacccacgac
ccggacgtcgccaaaaaagctgacagaaccgtttttatcagagacggagagttggtatta
gatgagagaggggatatcagccatgcttga

DBGET integrated database retrieval system