KEGG   Bacillus subtilis subsp. subtilis 168: BSU33280
Entry
BSU33280          CDS       T00010                                 

Symbol
yvrP
Name
(RefSeq) efflux system protein YvrP
  KO
K24950  membrane fusion protein, antimicrobial resistance system
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33280 (yvrP)
Transporters [BR:bsu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   BSU33280 (yvrP)
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl PASTA PTS_EIIA_1 Peptidase_M23
Other DBs
NCBI-GeneID: 938618
NCBI-ProteinID: NP_391209
Pasteur: BG14152
BSORF: BG14152
UniProt: O35007 A0A6M3ZGK6
Position
complement(3414023..3415216)
AA seq 397 aa
MSKKKKWLIGGAICAGVLVLAGIGAGGFYFFTHMNQVAVSSEPYAESVAVYMGGDSESGQ
TFSGKVEPEKQQKVYIDSEKGSIKKTYVKEGDQVKKGDKLFEYEGEDHSDEVEQANLQIE
MTNLQINRLQKSITETEKKLKVAGKEEKNQLQDELDQTNFDLKTSQLELKQHQKELAGLT
KNKGSNVITSKHDGIVQSVNQDIADGATGDQAAGPYIQIVSTGKYLVKSQINELLMDTIK
KGSKVRVTLKTGGEGEWKGKVTSIGKLPAGAGEGEESESFADEEMNPQSSNYPFTILLDS
HKGLEVGYHVNIEVMSDNADADTIKLPSDMVIQDDGEPYVWKADENHKAVKQPVEIGETD
ENDMVEIKSGLTPEDYVIYPDPAVKEGKQVTVNADTE
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtgtccaagaagaaaaaatggcttattggcggtgcgatatgtgccggtgtgcttgtattg
gctgggatcggcgctggcggtttttacttttttactcacatgaaccaagttgccgtatca
tcggagccctatgctgaatcggtcgcggtatacatgggaggagattcagaatcaggccaa
acgttttctggaaaggttgaacctgagaaacagcagaaagtatacatagattcagaaaaa
ggcagcattaaaaaaacatacgtcaaagaaggcgatcaggttaaaaagggcgataagctt
tttgagtatgagggcgaggatcattctgatgaagtggagcaagccaatttgcaaattgaa
atgacaaatctgcaaatcaaccgtttgcaaaaatcaataacggaaacggaaaaaaagctg
aaagttgcaggaaaagaagagaaaaaccagcttcaagatgaacttgatcaaaccaatttc
gatttgaaaacaagccagcttgaactgaagcagcatcaaaaagaactggctggcctgacg
aaaaacaaaggttccaatgtcattacaagcaagcatgacggaatcgttcaaagcgtcaat
caggatatcgctgacggtgcaacaggcgaccaggcagcaggcccgtatatccagattgtt
tcgacaggcaaatatctggtcaaaagccaaatcaatgagctgttaatggacacgatcaaa
aaaggcagcaaagtcagggtcacgctgaaaacaggcggtgagggcgagtggaaaggaaag
gtcacctcgatcggcaagcttccagcgggagcaggcgagggtgaagaatcagaaagcttt
gctgatgaagaaatgaatccccagtcctctaactatcctttcaccattttattagacagc
cataaaggtcttgaagtcggctatcatgtcaacatcgaagtgatgagtgataatgctgat
gcggacacgatcaagctgccgtccgacatggtcattcaggatgacggcgaaccgtacgta
tggaaagctgatgagaatcacaaagcggttaagcagcctgttgaaatcggagagactgat
gaaaatgacatggtggaaattaagagcggcctgacgccggaagattatgtgatctatcct
gatcccgcggtcaaggaaggaaagcaggttacagtcaatgctgacactgaataa

DBGET integrated database retrieval system