KEGG   Bacillus subtilis subsp. subtilis 168: BSU33280Help
Entry
BSU33280          CDS       T00010                                 

Gene name
yvrP
Definition
(RefSeq) efflux system protein YvrP
  KO
K02005  HlyD family secretion protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BSU33280 (yvrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl PASTA RnfC_N PTS_EIIA_1 DAGK_cat Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 938618
NCBI-ProteinID: NP_391209
Pasteur: BG14152
BSORF: BG14152
UniProt: O35007
Position
complement(3414023..3415216)
Genome map
AA seq 397 aa AA seqDB search
MSKKKKWLIGGAICAGVLVLAGIGAGGFYFFTHMNQVAVSSEPYAESVAVYMGGDSESGQ
TFSGKVEPEKQQKVYIDSEKGSIKKTYVKEGDQVKKGDKLFEYEGEDHSDEVEQANLQIE
MTNLQINRLQKSITETEKKLKVAGKEEKNQLQDELDQTNFDLKTSQLELKQHQKELAGLT
KNKGSNVITSKHDGIVQSVNQDIADGATGDQAAGPYIQIVSTGKYLVKSQINELLMDTIK
KGSKVRVTLKTGGEGEWKGKVTSIGKLPAGAGEGEESESFADEEMNPQSSNYPFTILLDS
HKGLEVGYHVNIEVMSDNADADTIKLPSDMVIQDDGEPYVWKADENHKAVKQPVEIGETD
ENDMVEIKSGLTPEDYVIYPDPAVKEGKQVTVNADTE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaagaagaaaaaatggcttattggcggtgcgatatgtgccggtgtgcttgtattg
gctgggatcggcgctggcggtttttacttttttactcacatgaaccaagttgccgtatca
tcggagccctatgctgaatcggtcgcggtatacatgggaggagattcagaatcaggccaa
acgttttctggaaaggttgaacctgagaaacagcagaaagtatacatagattcagaaaaa
ggcagcattaaaaaaacatacgtcaaagaaggcgatcaggttaaaaagggcgataagctt
tttgagtatgagggcgaggatcattctgatgaagtggagcaagccaatttgcaaattgaa
atgacaaatctgcaaatcaaccgtttgcaaaaatcaataacggaaacggaaaaaaagctg
aaagttgcaggaaaagaagagaaaaaccagcttcaagatgaacttgatcaaaccaatttc
gatttgaaaacaagccagcttgaactgaagcagcatcaaaaagaactggctggcctgacg
aaaaacaaaggttccaatgtcattacaagcaagcatgacggaatcgttcaaagcgtcaat
caggatatcgctgacggtgcaacaggcgaccaggcagcaggcccgtatatccagattgtt
tcgacaggcaaatatctggtcaaaagccaaatcaatgagctgttaatggacacgatcaaa
aaaggcagcaaagtcagggtcacgctgaaaacaggcggtgagggcgagtggaaaggaaag
gtcacctcgatcggcaagcttccagcgggagcaggcgagggtgaagaatcagaaagcttt
gctgatgaagaaatgaatccccagtcctctaactatcctttcaccattttattagacagc
cataaaggtcttgaagtcggctatcatgtcaacatcgaagtgatgagtgataatgctgat
gcggacacgatcaagctgccgtccgacatggtcattcaggatgacggcgaaccgtacgta
tggaaagctgatgagaatcacaaagcggttaagcagcctgttgaaatcggagagactgat
gaaaatgacatggtggaaattaagagcggcctgacgccggaagattatgtgatctatcct
gatcccgcggtcaaggaaggaaagcaggttacagtcaatgctgacactgaataa

DBGET integrated database retrieval system