KEGG   Bacillus subtilis subsp. subtilis 168: BSU33290
Entry
BSU33290          CDS       T00010                                 

Symbol
fhuC
Name
(RefSeq) iron(3+)-hydroxamate import ATP-binding protein FhuC
  KO
K25290  ferric hydroxamate/heme transport system ATP-binding protein [EC:7.2.2.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33290 (fhuC)
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.16  ABC-type ferric hydroxamate transporter
     BSU33290 (fhuC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate/heme transporter
    BSU33290 (fhuC)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_29 ABC_ATPase AAA_16 AAA_23 Rad17 AAA_30 AAA_22 AAA_14 ATP-synt_ab AAA_5 PRK AAA_19 Mg_chelatase RsgA_GTPase AAA RNA_helicase AAA_25 ATP_bind_1 Cas_St_Csn2 AAA_27 Zeta_toxin AAA_33
Other DBs
NCBI-GeneID: 935994
NCBI-ProteinID: NP_391210
Pasteur: BG11390
BSORF: BG11390
UniProt: P49938 A0A6M3ZKS8
Position
complement(3415387..3416196)
AA seq 269 aa
MNSLSTEQLGIGYGDRVIVEDLNISIPKGKITTLIGPNGCGKSTILKTMSRIMRSHAGAV
YLNGKAIHKMSTKDIAKDMAILPQTPEAPSGLTVHELVSYGRFPHQSGFGRLNDEDRRII
KWALEETGMAEYAERPIEALSGGQRQRVWIAMALAQGTELLLLDEPTTYLDLAHQLEILQ
LLDRLNKEQGRTILMVIHDLNHAARFSHYMIALKKGTVIKEGTALEVMTPDILKQVFQID
AEIVTDPRTNKPVCLTYDLIKNEKELVTV
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaattcattatcaacggaacagcttggaatcggttatggcgacagggtgattgtagag
gatttaaatatatcgattcctaaagggaaaattaccaccttaattggcccgaacggctgc
gggaaatcaacgattttaaaaacaatgtccagaattatgcgttcacatgcaggtgccgtc
tatttaaacggcaaagcgattcataaaatgtctacaaaggacattgcaaaagatatggcg
attcttccacagacacctgaagcgccgagcggcctaacagtgcacgaattggtgtcgtac
ggcaggtttccgcatcaatcaggattcggcagattaaatgacgaagaccgccggattatc
aaatgggcgcttgaagaaacaggcatggctgaatatgctgaacggccgattgaggcattg
tcaggcggacagcgtcaacgtgtgtggattgccatggcgcttgcgcaagggacggaactg
cttctgctggatgaacctacaacgtatcttgatcttgcacatcagcttgaaattctgcag
ctgcttgacagactcaacaaagagcaagggcggacgattttaatggtcattcatgatctt
aaccatgcagctcgtttttctcattatatgatcgcgctcaaaaaaggcacggtcatcaag
gaaggaactgctctggaggtcatgacaccagacattttgaagcaggtatttcagattgat
gccgaaatcgtgactgatccccgtacaaataaacctgtatgcttgacatatgacttgatt
aaaaatgaaaaagagctagttactgtatga

DBGET integrated database retrieval system