KEGG   Bacillus subtilis subsp. subtilis 168: BSU33290Help
Entry
BSU33290          CDS       T00010                                 

Gene name
fhuC
Definition
(RefSeq) iron(3+)-hydroxamate import ATP-binding protein FhuC
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33290 (fhuC)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33290 (fhuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 ABC_ATPase AAA_29 AAA_16 AAA_23 Rad17 AAA_30 AAA_22 PRK AAA_14 AAA_5 ATP-synt_ab AAA_19 RsgA_GTPase Mg_chelatase AAA AAA_25 RNA_helicase ATP_bind_1 Cas_St_Csn2 AAA_27 AAA_33 Zeta_toxin AAA_24
Motif
Other DBs
NCBI-GeneID: 935994
NCBI-ProteinID: NP_391210
Pasteur: BG11390
BSORF: BG11390
UniProt: P49938
Position
complement(3415387..3416196)
Genome map
AA seq 269 aa AA seqDB search
MNSLSTEQLGIGYGDRVIVEDLNISIPKGKITTLIGPNGCGKSTILKTMSRIMRSHAGAV
YLNGKAIHKMSTKDIAKDMAILPQTPEAPSGLTVHELVSYGRFPHQSGFGRLNDEDRRII
KWALEETGMAEYAERPIEALSGGQRQRVWIAMALAQGTELLLLDEPTTYLDLAHQLEILQ
LLDRLNKEQGRTILMVIHDLNHAARFSHYMIALKKGTVIKEGTALEVMTPDILKQVFQID
AEIVTDPRTNKPVCLTYDLIKNEKELVTV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattatcaacggaacagcttggaatcggttatggcgacagggtgattgtagag
gatttaaatatatcgattcctaaagggaaaattaccaccttaattggcccgaacggctgc
gggaaatcaacgattttaaaaacaatgtccagaattatgcgttcacatgcaggtgccgtc
tatttaaacggcaaagcgattcataaaatgtctacaaaggacattgcaaaagatatggcg
attcttccacagacacctgaagcgccgagcggcctaacagtgcacgaattggtgtcgtac
ggcaggtttccgcatcaatcaggattcggcagattaaatgacgaagaccgccggattatc
aaatgggcgcttgaagaaacaggcatggctgaatatgctgaacggccgattgaggcattg
tcaggcggacagcgtcaacgtgtgtggattgccatggcgcttgcgcaagggacggaactg
cttctgctggatgaacctacaacgtatcttgatcttgcacatcagcttgaaattctgcag
ctgcttgacagactcaacaaagagcaagggcggacgattttaatggtcattcatgatctt
aaccatgcagctcgtttttctcattatatgatcgcgctcaaaaaaggcacggtcatcaag
gaaggaactgctctggaggtcatgacaccagacattttgaagcaggtatttcagattgat
gccgaaatcgtgactgatccccgtacaaataaacctgtatgcttgacatatgacttgatt
aaaaatgaaaaagagctagttactgtatga

DBGET integrated database retrieval system