KEGG   Bacillus subtilis subsp. subtilis 168: BSU33300
Entry
BSU33300          CDS       T00010                                 

Symbol
fhuG
Name
(RefSeq) iron(3+)-hydroxamate import system permease protein FhuG
  KO
K25289  ferric hydroxamate/heme transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33300 (fhuG)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate/heme transporter
    BSU33300 (fhuG)
SSDB
Motif
Pfam: FecCD
Other DBs
NCBI-GeneID: 938619
NCBI-ProteinID: NP_391211
Pasteur: BG11391
BSORF: BG11391
UniProt: P49937 A0A6M3ZGV6
Position
complement(3416212..3417222)
AA seq 336 aa
MKTKTNKPLIVMAVTFLLIVVVFFISLNLGVIKIAPLKTLQVFFGQGTARDELVLFEFRL
PRIILSLLVGAGISVAGAILQSVSQNELAEPGILGINAGGSLAVVLFIYFFQGSASDLSF
FGTFMLPFSALAGAILAAFLIYILAWKKGVTPIRLILVGIGVNAGFNALLLIFQLKMDPH
DFMQAAVWISGSIWGANWNMIWAILPWIVILLLFTLYKARYLNIMQLGDQLATGLGTAVE
KERRILLLAAVTLAASCVAAAGGIAFLGLIAPHVARRLTGPRHQTLIPVSAFIGSFLFLL
ADTLARNVLAPSEIPVGLVISVLGAPYFIYLLMKAN
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaacaaaaacaaacaaaccgctcattgtaatggctgtgacctttttgcttatcgtg
gtggtcttttttatcagtctcaatttgggcgttatcaaaattgcaccgcttaaaacgctt
caggtctttttcggccaaggaacggcgcgtgatgaacttgtcttatttgagttcaggctg
ccccggatcatcctttctttgcttgttggagcagggatctccgtagctggagccattttg
caaagcgtgtctcaaaatgaacttgccgagcctggtattctcggaattaacgccggcggt
tcacttgctgtagtgctttttatatacttttttcaagggtcagcttcagatcttagcttt
ttcggaacatttatgctgccgttcagtgctttggcaggagcaatcctcgctgcgtttctc
atttatattctggcatggaaaaaaggcgtgacaccgattcggctgattttagtcggcata
ggggtgaatgccggattcaacgccctgttgctgatttttcagctcaagatggaccctcat
gattttatgcaagccgcggtttggatatccggctcaatatggggggcgaactggaatatg
atctgggcgattctcccttggattgtgatcttgcttctgtttactttatataaggcacgc
tatttgaacattatgcagctcggagaccaattggcgaccgggctgggcaccgctgttgaa
aaggaaagacggattcttcttctggcagcggtcactcttgccgcttcatgcgtggcagct
gcggggggcattgcgtttctcggattgatcgcgccgcatgtggctagaaggctgaccggt
ccacgtcaccagacgctgataccggtctccgccttcatcggctcattcctgtttttgctt
gctgatacgctggcgagaaatgtattggcaccatcagaaattccggtcggacttgtcatt
tccgtgctaggtgcgccttactttatttatttattgatgaaagcgaattag

DBGET integrated database retrieval system