KEGG   Bacillus subtilis subsp. subtilis 168: BSU33300Help
Entry
BSU33300          CDS       T00010                                 

Gene name
fhuG
Definition
(RefSeq) iron(3+)-hydroxamate import system permease protein FhuG
  KO
K02015  iron complex transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33300 (fhuG)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33300 (fhuG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-GeneID: 938619
NCBI-ProteinID: NP_391211
Pasteur: BG11391
BSORF: BG11391
UniProt: P49937
Position
complement(3416212..3417222)
Genome map
AA seq 336 aa AA seqDB search
MKTKTNKPLIVMAVTFLLIVVVFFISLNLGVIKIAPLKTLQVFFGQGTARDELVLFEFRL
PRIILSLLVGAGISVAGAILQSVSQNELAEPGILGINAGGSLAVVLFIYFFQGSASDLSF
FGTFMLPFSALAGAILAAFLIYILAWKKGVTPIRLILVGIGVNAGFNALLLIFQLKMDPH
DFMQAAVWISGSIWGANWNMIWAILPWIVILLLFTLYKARYLNIMQLGDQLATGLGTAVE
KERRILLLAAVTLAASCVAAAGGIAFLGLIAPHVARRLTGPRHQTLIPVSAFIGSFLFLL
ADTLARNVLAPSEIPVGLVISVLGAPYFIYLLMKAN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaacaaacaaaccgctcattgtaatggctgtgacctttttgcttatcgtg
gtggtcttttttatcagtctcaatttgggcgttatcaaaattgcaccgcttaaaacgctt
caggtctttttcggccaaggaacggcgcgtgatgaacttgtcttatttgagttcaggctg
ccccggatcatcctttctttgcttgttggagcagggatctccgtagctggagccattttg
caaagcgtgtctcaaaatgaacttgccgagcctggtattctcggaattaacgccggcggt
tcacttgctgtagtgctttttatatacttttttcaagggtcagcttcagatcttagcttt
ttcggaacatttatgctgccgttcagtgctttggcaggagcaatcctcgctgcgtttctc
atttatattctggcatggaaaaaaggcgtgacaccgattcggctgattttagtcggcata
ggggtgaatgccggattcaacgccctgttgctgatttttcagctcaagatggaccctcat
gattttatgcaagccgcggtttggatatccggctcaatatggggggcgaactggaatatg
atctgggcgattctcccttggattgtgatcttgcttctgtttactttatataaggcacgc
tatttgaacattatgcagctcggagaccaattggcgaccgggctgggcaccgctgttgaa
aaggaaagacggattcttcttctggcagcggtcactcttgccgcttcatgcgtggcagct
gcggggggcattgcgtttctcggattgatcgcgccgcatgtggctagaaggctgaccggt
ccacgtcaccagacgctgataccggtctccgccttcatcggctcattcctgtttttgctt
gctgatacgctggcgagaaatgtattggcaccatcagaaattccggtcggacttgtcatt
tccgtgctaggtgcgccttactttatttatttattgatgaaagcgaattag

DBGET integrated database retrieval system