KEGG   Bacillus subtilis subsp. subtilis 168: BSU33310
Entry
BSU33310          CDS       T00010                                 

Symbol
fhuB
Name
(RefSeq) iron(3+)-hydroxamate import system permease protein FhuB
  KO
K25288  ferric hydroxamate/heme transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33310 (fhuB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate/heme transporter
    BSU33310 (fhuB)
SSDB
Motif
Pfam: FecCD
Other DBs
NCBI-GeneID: 937085
NCBI-ProteinID: NP_391212
Pasteur: BG11389
BSORF: BG11389
UniProt: P49936
Position
complement(3417222..3418376)
AA seq 384 aa
MHFHFCSKHSIKSAEKSDILKQQLIIIISNRKEVRQLSQHKNIRTASEEIQWTSRTYGAV
IVLIAGLCLLCLGAFLSISLGAADIHLRTVWEAIFHYQPTKTSHQIIHDLRLPRTAAAAL
VGALLAVSGAIMQGMTRNPLAEPSIMGVTSGSAFAVSIAFAFFPGLSAMGLVLWSFAGAG
LGASTVMGIGMFSRGGLTPVKLALAGTAVTYFFTGISTAIAIRFDVAQDISFWYAGGVAG
VKWSGVQLLLIAGAVGLTLAFFIARSVTVLSLGDDLAKGLGQYTSAVKLVGMLIVVILTG
AAVSIAGTIAFIGLIIPHITRFLVGVDYRWIIPCSAVLGAVLLVFADIAARLVNAPFETP
VGALTSLIGVPFFFYLARRERRGL
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgcattttcatttttgttcaaaacactctattaaatcagctgaaaaaagtgatatactg
aaacagcaattgataatcattatcagtaacagaaaggaagtacggcagttgagtcaacat
aaaaatatacggactgcatcagaagaaatccaatggacgtcaaggacatatggcgcggtc
atcgtccttatcgcaggtctatgcctgctttgccttggcgcatttttatccatatcccta
ggtgcagcggatattcatttgcgcactgtatgggaggccatttttcattatcagccgaca
aagacatctcaccaaattatacatgatcttcggcttccgagaacggcggctgccgcgctt
gtaggcgcattgttggcagtgtcgggagcaatcatgcaggggatgacgagaaaccctttg
gcagagccttcgattatgggtgtgacatcaggctctgcgtttgcggtttcgattgcgttt
gccttttttcccggactttctgcaatggggcttgtgctatggtcctttgcgggagcgggg
ctgggggcatcgacggtaatgggcataggcatgttttcaaggggcggacttacgcctgta
aagcttgctctggcgggtacggcagttacttatttctttaccggcatttcaactgccatt
gcaatccgctttgatgtcgctcaggatatcagcttttggtacgcaggcggggtagcgggt
gtgaaatggtcgggggtccagcttttgcttattgcaggggctgtcggtttaacgctcgcg
tttttcatcgcccggtctgttacagtgttaagtctcggtgacgatctggcaaaagggctt
ggacaatatacatcagcggtgaaactggttggcatgcttattgtagtaattctgaccgga
gctgcggtttccattgccggcaccattgcatttatcgggctgatcattccgcatattacc
cgttttttggtcggtgtggattatcggtggatcattccttgctcggcggtgctcggtgct
gttttgcttgtttttgctgacatagcggccagactcgtaaatgcgccctttgaaacgcct
gtcggcgcgctgacttctcttatcggcgttccctttttcttttatttggcacgtcgtgaa
aggagagggctgtaa

DBGET integrated database retrieval system