KEGG   Bacillus subtilis subsp. subtilis 168: BSU33320
Entry
BSU33320          CDS       T00010                                 

Symbol
fhuD
Name
(RefSeq) iron(3+)-hydroxamate-binding protein FhuD
  KO
K25308  ferric hydroxamate/heme transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33320 (fhuD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate/heme transporter
    BSU33320 (fhuD)
SSDB
Motif
Pfam: Peripla_BP_2 DUF4185 Cep57_CLD
Other DBs
NCBI-GeneID: 935996
NCBI-ProteinID: NP_391213
Pasteur: BG10828
BSORF: BG10828
UniProt: P37580 A0A6M4JP53
Structure
PDB: 
3G9Q 3HXP

Position
3418474..3419421
AA seq 315 aa
MTHIYKKLGAAFFALLLIAALAACGNNSESKGSASDSKGAETFTYKAENGNVKIPKHPKR
VVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLII
VWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAK
TKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYT
SISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPI
SLEGQLEFITESLTK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacccatatatacaagaaactcggagccgcgttttttgccctgttattgattgcagcg
ctggcagcctgcgggaataactcagaaagcaaaggttctgcctctgattcaaaaggcgca
gaaacctttacatacaaggctgaaaacggaaatgtaaaaatcccgaagcatcctaaacgg
gtggttgtcatggcagacggctattacggctacttcaaaacactcggcatcaacgttgta
ggtgcgcctgagaatgtatttaaaaacccttactacaaaggaaaaaccaacggcgtcgaa
aacatcggagacggcacttcggttgaaaaggtcattgatttgaaccctgacctgattatc
gtctggacaacacagggcgctgatattaaaaagcttgaaaaaattgcgccgactgtcgca
gtaaaatacgataagctcgacaacatcgaacagctgaaagaatttgcaaaaatgacggga
actgaagataaagctgaaaaatggctggccaagtgggataaaaaagttgcggccgctaaa
acaaaaatcaaaaaagcggtcggtgacaaaaccatttccattatgcaaacgaacggaaaa
gacatttacgtatttggtaaagactttggaagaggcggaagcatcatttacaaagacctc
ggcctgcaggctacaaagctgacaaaagaaaaagccattgaccaggggccaggttataca
agtatttcattagagaagctccctgacttcgccggagattacattttcgcgggcccatgg
caatcaggcggtgatgatggcggcgtttttgaaagctccatttggaagaacctgaatgcc
gttaaaaatggccatgtatacaagatggatccgatcggattctatttcacagacccgatt
tcattagaaggacaactggagtttattacggaaagcttgactaaataa

DBGET integrated database retrieval system