KEGG   Bacillus subtilis subsp. subtilis 168: BSU33320Help
Entry
BSU33320          CDS       T00010                                 

Gene name
fhuD
Definition
(RefSeq) iron(3+)-hydroxamate-binding protein FhuD
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33320 (fhuD)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33320 (fhuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 ETRAMP Cep57_CLD
Motif
Other DBs
NCBI-GeneID: 935996
NCBI-ProteinID: NP_391213
Pasteur: BG10828
BSORF: BG10828
UniProt: P37580
Structure
PDB: 

Position
3418474..3419421
Genome map
AA seq 315 aa AA seqDB search
MTHIYKKLGAAFFALLLIAALAACGNNSESKGSASDSKGAETFTYKAENGNVKIPKHPKR
VVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLII
VWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAK
TKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYT
SISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPI
SLEGQLEFITESLTK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccatatatacaagaaactcggagccgcgttttttgccctgttattgattgcagcg
ctggcagcctgcgggaataactcagaaagcaaaggttctgcctctgattcaaaaggcgca
gaaacctttacatacaaggctgaaaacggaaatgtaaaaatcccgaagcatcctaaacgg
gtggttgtcatggcagacggctattacggctacttcaaaacactcggcatcaacgttgta
ggtgcgcctgagaatgtatttaaaaacccttactacaaaggaaaaaccaacggcgtcgaa
aacatcggagacggcacttcggttgaaaaggtcattgatttgaaccctgacctgattatc
gtctggacaacacagggcgctgatattaaaaagcttgaaaaaattgcgccgactgtcgca
gtaaaatacgataagctcgacaacatcgaacagctgaaagaatttgcaaaaatgacggga
actgaagataaagctgaaaaatggctggccaagtgggataaaaaagttgcggccgctaaa
acaaaaatcaaaaaagcggtcggtgacaaaaccatttccattatgcaaacgaacggaaaa
gacatttacgtatttggtaaagactttggaagaggcggaagcatcatttacaaagacctc
ggcctgcaggctacaaagctgacaaaagaaaaagccattgaccaggggccaggttataca
agtatttcattagagaagctccctgacttcgccggagattacattttcgcgggcccatgg
caatcaggcggtgatgatggcggcgtttttgaaagctccatttggaagaacctgaatgcc
gttaaaaatggccatgtatacaagatggatccgatcggattctatttcacagacccgatt
tcattagaaggacaactggagtttattacggaaagcttgactaaataa

DBGET integrated database retrieval system