KEGG   Bacillus subtilis subsp. subtilis 168: BSU33330Help
Entry
BSU33330          CDS       T00010                                 

Gene name
lysP
Definition
(RefSeq) arginine/ornithine antiporter
  KO
K03758  arginine:ornithine antiporter / lysine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33330 (lysP)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU33330 (lysP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Spore_permease TssN
Motif
Other DBs
NCBI-GeneID: 936000
NCBI-ProteinID: NP_391214
Pasteur: BG14154
BSORF: BG14154
UniProt: O32204
Position
complement(3419656..3421065)
Genome map
AA seq 469 aa AA seqDB search
MEQTKKWGFWLLTAFVVGNMVGSGIFSLPSSLASIASPFGATSAWLLTGAGVLMIALVFG
HLSIRKPELTAGPQSYARALFSDPKKGNAAGFTMVWGYWVASWISNVAIITSLAGYLTSF
FPILVDKREMFSIGGQEVTLGQLLTFAVCTILLWGTHAILVASINGASKLNFVTTLSKVL
GFVFFIVAGLFVFQTSLFGHFYFPVQGENGTSIGIGGQVHNAAISTLWAFVGIESAVILS
GRARSQRDVKRATITGLLIALSIYIIVTLITMGVLPHDKLVGSEKPFVDVLYAIVGNAGS
VIMALLAILCLFGTMLGWILLGSEVPYQAAKAGDFPAFFAKTNKKGSPVIALIITNVMSQ
VFIFSVISRTISDAFTFLTTAATLAYLIPYLVSAIYSLKVVIKGETYDQLKGSRVRDGLI
AILACAYSVFVIVTGTADLTTFILGIGLFFVGLIVYPFVSNKFQKEKQA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaacagacaaaaaaatggggtttttggttattaacggcgtttgtcgttggaaatatg
gttggatcaggaattttctccttgccgagctcgcttgcttcaattgcgagtccgtttgga
gctacgtccgcctggcttttgacaggtgccggcgtgctgatgattgcacttgtgttcgga
cacttgtccattcgcaagcctgaactgacagcgggaccgcaaagttatgcaagagcgctg
ttttctgacccgaaaaaaggcaacgctgccggtttcacaatggtgtggggctactgggtg
gcgagctggatcagtaacgtggcgatcatcacaagtctcgccggttacttgacttcgttc
ttcccgatcttggttgataaacgtgagatgttttcgatcggcgggcaagaggtgacactc
ggccaattactgacgtttgccgtatgtacgatcttgttatggggaacgcacgcgattctt
gttgccagcattaacggcgcaagtaaattaaactttgtcacaacgctttctaaagtatta
ggttttgtcttctttatcgttgccggtttgtttgtgtttcaaacgtcattattcggtcat
ttttatttcccggttcaaggagaaaacggcacaagcattggaattggtggccaggttcat
aacgctgcgatttctacactgtgggcgtttgtcggaattgaatccgcggtgatcctgtcc
ggccgtgcgcgctctcagcgtgatgtgaaacgtgcgacaattaccggcttgctgattgcc
ttgagcatatatattattgtgactttaattacgatgggtgttctgccgcatgataagctt
gtcggctctgaaaaaccatttgttgatgtactctatgcgattgttggaaacgcgggaagc
gtgattatggcgcttttggctatcctttgtttattcggaacgatgctcggctggattttg
cttggctctgaggtgccataccaagccgctaaagcaggagatttcccggcattttttgca
aaaacgaataaaaagggaagtccggtcattgcactcattattacaaacgtcatgtcacag
gtcttcattttctcggttatttcccggacaataagtgacgcatttacatttttaacgaca
gcggctacactcgcatatttaattccgtatctggtatctgcaatctacagcttgaaggta
gtcatcaaaggtgaaacgtatgaccagctgaaaggctcccgtgtaagagacggattgatc
gcgatactggcgtgtgcatactccgtgtttgttatcgtaacaggcacagcagatttaacg
acatttatactcggcatcggtttattctttgtcggcttaatcgtttatccatttgtgagt
aacaagttccagaaagaaaaacaagcataa

DBGET integrated database retrieval system