KEGG   Bacillus subtilis subsp. subtilis 168: BSU33340
Entry
BSU33340          CDS       T00010                                 

Symbol
sspJ
Name
(RefSeq) small acid-soluble spore protein J
  KO
K06427  small acid-soluble spore protein J (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU33340 (sspJ)
SSDB
Motif
Pfam: Spore_SspJ
Other DBs
NCBI-GeneID: 2914269
NCBI-ProteinID: YP_054593
Pasteur: BG14174
BSORF: BG14174
UniProt: Q7WY58 A0A6M4JP63
Position
complement(3421465..3421605)
AA seq 46 aa
MGFFNKDKGKRSEKEKNVIQGALEDAGSALKDDPLQEAVQKKKNNR
NT seq 141 nt   +upstreamnt  +downstreamnt
atgggtttctttaataaagataaaggaaaacgttccgaaaaagaaaaaaacgtaatccaa
ggagctcttgaagatgctggttcagctctaaaagatgatccgcttcaagaagctgtgcaa
aaaaagaaaaataatcgataa

DBGET integrated database retrieval system