KEGG   Bacillus subtilis subsp. subtilis 168: BSU33360
Entry
BSU33360          CDS       T00010                                 

Symbol
yvgJ
Name
(RefSeq) lipoteichoic acid synthase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sulfatase DUF229 DUF4149 Phosphodiest
Other DBs
NCBI-GeneID: 936006
NCBI-ProteinID: NP_391216
Pasteur: BG14092
BSORF: BG14092
UniProt: O32206 A0A6M3ZG90
Position
3422354..3424207
AA seq 617 aa
MKGTFFHNQRFLCFSILFMWIKTYVIYKLGFDLQIDTLLEELMLLVNPLSFILPLFGIGL
FLKENKQRAFLLIANLVLTVILISNTIFYGFYIDFITIPVLFQASNMSDMGSSVKELFHP
LFIALFVDLVFLLLFARKTKHPQTKAAPHTIKRYYAASCGMLLCTLALAEVQQPKLLAHS
FDREMLVKSIGLFQFHIYDTISQTVNISAKAFADEDSITAIKNYTEADYSKPDQSKFGLA
KGRNVIFVTLESTQSFVLNEKVNGKEITPFMNDLIKKSYSFDHFYQQTEQGKTSDSEFIV
ANSLYPSLSGAVFFTKSDHQFHTMYKSLKQHDYYSAVFHANHKTFWNRDVMYDTFGIDRF
FDVDDFHVTPGTSTSWGLKDKEFLEQSAKKLKSLPQPFYSSFITLTNHFPFEIDEKDQLI
DEFDSSSDLLNRYVTTVRYEDEALKHFIKKLKDEGLYENSMIVFMGDHYGISEAHNEAMA
EFLGKDEITPYDNVQLQRVPFIIHIPGITDQQPETIPDAGGQVDVRPTLMHLLGVETKGD
IQFGNDLLSGDRTPFAVLRNGSFITNDYVYTKNTCYSQKTGEVLEDQDACLPYKEKANEE
LSLSDKILNGDLLRFSE
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgaaaggaaccttttttcacaatcagcggtttttatgtttttcgatcttatttatgtgg
atcaaaacgtatgtgatatataaactcggctttgatttgcaaatcgatactctgttggag
gagctaatgctgctggtcaacccgctcagctttattcttcctttattcgggatcggcctg
tttctaaaagaaaacaagcagcgggcctttttgctgattgccaatttggttctgactgtt
atcttgatctctaatacgattttttacggcttttatatcgattttattaccatcccggtt
ttatttcaggccagcaacatgagcgatatgggcagcagtgtaaaagaactgttccatcct
ctgtttatcgccctgtttgtggatttggtttttctgctgttgttcgccagaaaaaccaaa
cacccacagacaaaagccgctccccacacgatcaaacggtactatgcagcttcctgcgga
atgcttttatgcacactggcacttgcagaagtacagcagccgaagcttttggcacattct
tttgaccgggaaatgctagtcaaaagcatcggcctgtttcagttccatatttacgataca
atttctcagactgttaatatcagcgcgaaagcttttgccgatgaagacagtataactgcc
attaaaaactacacagaggctgattacagcaagcctgatcaaagcaaattcggtcttgca
aaggggcgcaatgtcatctttgtaacacttgagtcgacccaaagctttgttctgaatgaa
aaagtaaatggaaaagaaattaccccatttatgaatgatctcataaaaaaaagctattcc
tttgatcatttctatcagcaaacagaacaaggcaaaacatcagattcagaatttatcgtc
gctaactcactgtatccctcccttagcggcgccgtctttttcacgaaaagcgaccatcaa
tttcatacgatgtataaatcgctgaagcagcacgattattattcagccgtctttcacgct
aaccataaaacattttggaacagagatgtcatgtacgatacatttggcattgaccgcttt
tttgatgttgatgattttcatgtcactcccgggacatcgacaagctggggcttaaaagac
aaagaatttttagagcagtccgccaaaaagctgaaaagcctaccgcagccgttctacagc
agttttatcacgttaacgaatcattttccgtttgagattgatgaaaaggatcagctgata
gatgaattcgattcaagcagtgatctgttaaaccgctatgtgaccacggttcgctatgag
gatgaagcattgaagcattttatcaaaaaactgaaggacgaaggcttatacgaaaattcg
atgatcgtatttatgggagatcattacggcatttctgaagcccataacgaggcaatggct
gagtttttagggaaagacgaaatcacaccgtatgacaacgttcagctccagcgggtgccg
tttatcatacatatcccgggaatcaccgatcaacagccggaaaccatccctgatgccggg
ggacaggtcgacgtcaggccgacgctgatgcatttgctcggcgttgagacaaaaggcgat
atccaattcggcaatgatttgctgtcgggcgaccgcaccccattcgccgttctgcgaaac
ggcagctttattacgaacgattatgtatacacaaagaacacgtgctatagccaaaaaaca
ggtgaagtgctggaagatcaggatgcgtgcctcccttacaaggagaaagcaaacgaagaa
ctgtctctctctgataaaattttaaatggtgacctgctcaggttttccgaatga

DBGET integrated database retrieval system