KEGG   Bacillus subtilis subsp. subtilis 168: BSU33370
Entry
BSU33370          CDS       T00010                                 

Symbol
yvgK
Name
(RefSeq) hypothetical protein
  KO
K07219  putative molybdopterin biosynthesis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSU33370 (yvgK)
SSDB
Motif
Pfam: PBP_like HTH_17 SBP_bac_11 Phosphonate-bd SBP_bac_3 HTH_22
Other DBs
NCBI-GeneID: 936008
NCBI-ProteinID: NP_391217
Pasteur: BG14093
BSORF: BG14093
UniProt: O32207 A0A6M3ZMA6
Position
complement(3424235..3425161)
AA seq 308 aa
MNETSSYTIEEVAGLLKVSKLTVYDLIKKGVLPAYRVGRQMRVDEEDLKQYKTNMRMSQP
IAAKEAPKQVQEAEPDGRPNVMISGQDISMDILSKHLENAIQETPLRKYKGSLNSLIDMY
QGKCDIVSLHLYDAETGQYNAPYVKRILTGEPFCLINVVLRKAGLYVQKGNPKNIQGWKD
LKRADIRIINREKGSGARVLLDEQLGLLGVNPADVVGYGDIVTDHYAAASQVSSGQADAG
IGAQHAAHMGSVDFIPLIDEQYDIVVLKKNEQLLKAVKEILNSEDYKANLSHLNGYETKL
TGKVILET
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaatgaaacctcttcctatacgatagaagaagttgcaggtctgctgaaggtatcaaag
ctgaccgtttatgacttgattaaaaaaggcgtgctgcctgcttaccgtgtcggaaggcag
atgcgtgtggatgaagaagatttaaagcaatataaaacgaatatgagaatgtctcagccc
atcgctgcaaaagaagcgccgaaacaggtgcaggaggctgagccggacggcagaccaaat
gtcatgatcagcggacaggacatttcgatggatatcctcagcaagcatttggagaatgcc
attcaggagacgccgctccgtaaatacaaaggaagcttaaacagcctgattgatatgtat
caaggcaagtgtgacattgtcagcctccatttgtacgatgcagaaacgggccagtataac
gcgccttatgtaaaacggattttgacaggtgaaccgttttgtctcatcaatgtcgttctc
cgcaaagcaggactgtatgtgcaaaaagggaatccgaaaaacattcaaggctggaaagac
ttgaaaagagccgatatccggatcatcaacagggaaaagggttctggcgcaagggtgctc
cttgatgaacagcttggcttgcttggtgtgaatccggctgatgtagtgggatatggcgat
atcgtgactgatcattacgctgccgcttcacaagtttcaagcggacaggctgacgcggga
atcggggcacagcacgcggcacatatgggcagtgttgattttatcccgctcatcgacgaa
caatatgatatcgttgttttgaaaaaaaatgagcagttgctcaaagccgtgaaggagatt
ttgaattctgaggactacaaggcgaatctgtctcatttaaacggctatgaaacgaagctg
actggcaaggtgatattggaaacgtaa

DBGET integrated database retrieval system