KEGG   Bacillus subtilis subsp. subtilis 168: BSU33380Help
Entry
BSU33380          CDS       T00010                                 

Gene name
yvgL
Definition
(RefSeq) ABC transporter substrate-binding protein
  KO
K02020  molybdate transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33380 (yvgL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33380 (yvgL)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    BSU33380 (yvgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 PBP_like_2 SBP_bac_8 Phosphonate-bd SBP_bac_6 DUF2811
Motif
Other DBs
NCBI-GeneID: 936003
NCBI-ProteinID: NP_391218
Pasteur: BG14094
BSORF: BG14094
UniProt: O32208
Position
3425272..3426054
Genome map
AA seq 260 aa AA seqDB search
MFKKYSIFIAALTAFLLVAGCSSNQSSTDSEKKVTLTISAAASAQDALEEIQKNYEKDHQ
HITIQDNYGSSGALQKQISQGAGADLFFSAAEDKFKKLVDDGDIAKKDSTELVGNEIVLV
VPKNGDSPVTSFSNLAESEKIALGTPESVPAGAYGKESLTKLSLWDKVKDKIVYGKDVRQ
VLSYVETGNVDAGVVYKTDALVSKKVNIVDEAKADTHSPIVYPLGIVKDTKHRKEAKEFY
EYLQSDEAMKVFEKYGFTAE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaagtattctattttcatcgcagccttaactgcttttctgcttgtagcaggc
tgttcttcaaaccagtcttcaacggacagcgagaaaaaagtaacgttaaccatctcagct
gccgccagcgcgcaggatgcacttgaggaaatccaaaaaaattatgaaaaagatcatcaa
catataaccatccaagataactatggctcatccggcgccttgcaaaaacagatttctcaa
ggagcaggagcagatctgttcttctcagctgctgaggataaatttaaaaagctggtggat
gatggagatatcgcaaaaaaagacagcactgaattagtcggtaatgaaattgtgctggtc
gtaccgaaaaacggagattcacctgtgacaagcttcagcaatctggctgaatcagaaaaa
atcgctcttggcactccggaatccgtaccggcaggagcttatgggaaagaatcactgaca
aagctgtctttatgggacaaagtgaaggataaaattgtgtatggaaaagacgttcgccaa
gttctttcttatgttgaaaccggcaatgtagacgcaggtgttgtttataaaacagatgcc
ctagtctcgaaaaaggtcaacattgttgacgaggcaaaagcagatacacacagcccaatt
gtctatccgttaggaatcgtaaaagatacaaaacaccgtaaggaagcgaaggaattttac
gaatacctgcaatctgatgaagcaatgaaagtatttgagaaatatggctttactgccgag
tag

DBGET integrated database retrieval system