KEGG   Bacillus subtilis subsp. subtilis 168: BSU33390Help
Entry
BSU33390          CDS       T00010                                 

Gene name
yvgM
Definition
(RefSeq) molybdenum transport system permease protein YvgM
  KO
K02018  molybdate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33390 (yvgM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33390 (yvgM)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189]
    BSU33390 (yvgM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 936009
NCBI-ProteinID: NP_391219
Pasteur: BG14095
BSORF: BG14095
UniProt: O32209
Position
3426035..3426718
Genome map
AA seq 227 aa AA seqDB search
MALLPSSISASEFFTPVVLSFQVAAVAGIVVIILGTLAGAWMSRASFFGKTALETCFMLP
LVLPPTVVGFILIVIFGKHSFIGQAIEWIFQQPVIFTWWAAVIASAVVAFPLMYQSAKTG
FADIDPDIQGAAMVDGASRWKVFIHISVPLAYPSLLTGSILSLARALGEFGATLMFAGNI
PGVTQTLPTAIYVALDSGNNTLAWAWVVCIVVISFLMLFFIQQKKTH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctttactgccgagtagcataagcgcttcagaatttttcacacccgttgtgctttcc
tttcaggtggcggcagttgccggaattgttgtcattattctcggaacacttgctggagca
tggatgtcacgggcatcatttttcggaaaaacggcactcgaaacatgttttatgcttccg
ctcgttcttccgcctactgttgtcggttttattctgatcgtcattttcggaaagcacagc
ttcatcggacaagccatcgagtggattttccagcagcctgtcattttcacctggtgggcc
gctgtgatcgcctcggctgttgtagcctttccgcttatgtatcaatcagccaaaaccgga
tttgctgacattgatcccgatatacaaggtgcggcaatggtagacggcgctagcagatgg
aaagtgtttatccatatctccgtcccgcttgcctatccttcgttactgaccggaagcatc
cttagccttgcgcgggcgctcggagaatttggcgcaacactcatgtttgcaggaaacatc
cccggtgttacgcaaacactgccgacggcgatatatgtcgcattggattccggcaacaat
acccttgcttgggcgtgggtcgtctgtattgttgtcatttcctttttgatgctgtttttc
attcaacagaaaaaaacgcactaa

DBGET integrated database retrieval system