KEGG   Bacillus subtilis subsp. subtilis 168: BSU33400
Entry
BSU33400          CDS       T00010                                 

Symbol
yvgN
Name
(RefSeq) glyoxal reductase
  KO
K23257  methylglyoxal/glyoxal reductase [EC:1.1.1.283 1.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU33400 (yvgN)
   00640 Propanoate metabolism
    BSU33400 (yvgN)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.283  methylglyoxal reductase (NADPH)
     BSU33400 (yvgN)
    1.1.1.-  
     BSU33400 (yvgN)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 936001
NCBI-ProteinID: NP_391220
Pasteur: BG14096
BSORF: BG14096
UniProt: O32210 A0A6M4JP61
Structure
PDB: 
3F7J 3D3F

Position
complement(3426749..3427579)
AA seq 276 aa
MPTSLKDTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGV
GIGIKESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYK
DTWRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCK
GQGIQLEAWSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRII
ENADIFDFELSQEDMDKIDALNKDERVGPNPDELLF
NT seq 831 nt   +upstreamnt  +downstreamnt
gtgccaacaagtttaaaagatactgtaaagttacataacggagttgaaatgccttggttc
ggtctgggcgtttttaaagtagaaaatggtaatgaagcgactgaatcagtgaaagcggca
attaaaaatggctatcgcagtattgatacagcagcgatctacaaaaatgaagaaggcgtt
ggcatcgggattaaagaatccggtgtggcaagagaagagctcttcatcacatcaaaagtg
tggaatgaagatcaaggctatgaaacaacgcttgctgcctttgaaaaaagcctagaaaga
ctgcagcttgattacttagatttatatttgatccattggcctggcaaagataaatataaa
gatacatggcgcgcgcttgaaaagctgtacaaagacggcaaaattcgcgcgatcggcgtc
agcaatttccaagttcatcatttagaagagctgttgaaagatgctgaaatcaaaccgatg
gtgaaccaagttgaatttcaccctcgcttgacgcaaaaagaattaagagattactgcaaa
gggcaaggcattcagctggaagcgtggtctccgctcatgcagggacagcttttggataac
gaagtactgacacagattgctgaaaaacacaataaatctgtggctcaagtgattttgcgc
tgggatctgcagcatggagttgtaaccattccaaaatccattaaagaacaccgtatcatc
gaaaacgctgatatttttgatttcgaattgtctcaagaagacatggacaaaattgacgca
ttaaataaagatgagcgtgtcggtccaaatcctgatgagcttctgttttaa

DBGET integrated database retrieval system