KEGG   Bacillus subtilis subsp. subtilis 168: BSU33410
Entry
BSU33410          CDS       T00010                                 

Symbol
yvgO
Name
(RefSeq) stress response protein YvgO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: WYL_3
Other DBs
NCBI-GeneID: 936024
NCBI-ProteinID: NP_391221
Pasteur: BG14097
BSORF: BG14097
UniProt: O32211 A0A6M4JP59
Position
3427802..3428287
AA seq 161 aa
MKRIRIPMTLALGAALTIAPLSFASAEENPAPKMSQTTTAGTTAADVGLNVNLDVLGIAN
QIADAIKSAQNRDGFVKNLMESSFYASGQKYNVMVFNLSQEYEDHLNGVQFYGSAVYDGI
TYGIWVFEDGTFTNKGDGGWINWAFRGWFDRDGSTVAFHRP
NT seq 486 nt   +upstreamnt  +downstreamnt
ttgaaacgtattcgtatcccaatgacacttgctcttggtgccgctttgacaattgcccct
ttgtcctttgcttccgctgaagaaaatcctgctccgaagatgtcgcagacaactactgct
ggaacaactgccgctgatgtaggtttaaacgtcaacctggatgtacttggaattgccaac
cagatcgctgatgccatcaaatccgcacagaatagggatggctttgtgaaaaacctcatg
gagtcttccttctacgcgtccggccaaaaatataacgtcatggtctttaatttaagccag
gaatatgaagatcatttgaacggtgtgcaattttacggctcagccgtttacgacggcatt
acgtatggcatttgggtatttgaagatggaacctttacaaacaaaggcgatggcggctgg
atcaactgggccttcagaggctggttcgaccgggatggcagcactgtcgcatttcatcgc
ccttaa

DBGET integrated database retrieval system