KEGG   Bacillus subtilis subsp. subtilis 168: BSU33420
Entry
BSU33420          CDS       T00010                                 

Symbol
nhaK
Name
(RefSeq) sodium, potassium, lithium and rubidium/H(+) antiporter
  KO
K24163  monovalent cation/hydrogen antiporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33420 (nhaK)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU33420 (nhaK)
SSDB
Motif
Pfam: Na_H_Exchanger EST1
Other DBs
NCBI-GeneID: 936025
NCBI-ProteinID: NP_391222
Pasteur: BG14098
BSORF: BG14098
UniProt: O32212 A0A6M3ZFZ3
Position
complement(3428331..3430343)
AA seq 670 aa
MDIFLVVLVLLTIIAISNIVNRFIPFIPVPLIQVALGILAASFPQGLHFELNTELFFVLF
IAPLLFNDGKRTPRAELWNLRAPILLLALGLVFATVIVGGYTIHWMIPAIPLAAAFGLAA
ILSPTDVVAVSALSGRVKMPKGILRLLEGEGLMNDASGLVAFKFAIAAAVTGAFSLAQAA
VSFVFISLGGLLCGVVISFLIIRFRLFLRRLGMQDVTMHMLIQILTPFVIYLAAEEIGVS
GILAVVAGGITHAVEQDRLESTMIKLQIVSSSTWNIILFILNGLVFVILGTQIPDVISVI
FNDTAISNMKVIGYILVITFTLMLLRFLWVLFFWNGKWFFNKDQNIYKPGLRSTLLISIS
GVRGAVTLAGSFSIPYFLEDGTPFPERNLILFLAAGVILCTLVIATVVLPILTEKEEEDE
ERNKKLLTARRKLIKTALQTIKEDMNETNKTASLAVIAEYNEKMKNLRFQQYTSSNRIKK
HERKVRAQGVKAEQEALMKMLERGDIPEETANVLQERFNELEILYANPFKVGLSKTRLKR
LMYWIFFGEHKKPEMSILNEAGLIRATRVKTAKAAIEYLEKHKTDEHKEVFLSVITFYKQ
LIFRLEHSHHELKSSAHFENQKLEVKLKAVQAIRNEIQTLFEEREISRDISHELRQYIND
VEAAMLEGGE
NT seq 2013 nt   +upstreamnt  +downstreamnt
ttggacatatttttagttgtgctcgtattattaacgattattgcgatttctaatatcgtg
aaccggtttattccgtttattccggtgccgctgattcaagtggctcttgggattcttgcc
gcctcatttccacagggacttcattttgaattaaacaccgaattgttttttgttcttttt
atcgcgcctctgctatttaatgatggaaagaggacaccgcgggcagagctttggaattta
agggctccgattttattgcttgcactcggccttgtatttgcgactgtgattgtaggcggc
tacacgattcactggatgattcctgctattccgctggcagcggcctttggacttgcggcc
attctttcaccgactgatgtcgtcgctgtcagcgcattatcaggaagagtgaaaatgcca
aaagggattcttcgcctgctggaaggtgaggggctgatgaatgatgcatcaggtctggtg
gcctttaagtttgcgattgcagcggcagtgactggtgcattttcattagcacaagcggct
gtcagctttgtctttatttctctcggaggcttgctgtgcggggttgtcatttcatttttg
attattcgttttcgcctatttctgcgccgccttggcatgcaggatgtcacgatgcatatg
ctgattcaaattctgacgccgtttgtgatttatttggcagctgaagaaatcggcgtttcg
ggcattttagctgttgtagctggcggtattacccatgcggttgaacaggatcgtctggaa
tcaacgatgatcaagctgcaaatcgtctcctcaagtacgtggaacattattttatttatt
ttgaacggcctggtcttcgttattctcggcacgcaaatccctgatgttatttctgttatc
tttaacgacactgccatcagcaacatgaaggtgatcggctatatcctagtcatcacattt
acattaatgctccttagattcctgtgggtgctgttcttctggaacggcaaatggttcttt
aataaagatcagaacatctataaaccgggtcttcgttcgacgctgttaatttcgatttcc
ggtgtgcgtggagcagtaacgcttgcaggttctttttccattccgtatttcctggaggac
ggtacgccgtttccggaaagaaatctgattctctttttagcagccggcgtcattttatgc
acgcttgtcattgccaccgttgtgctgccaattctgactgaaaaagaagaagaggacgag
gaacgaaataagaagctgctgacggcgagacgcaagttgatcaaaacagcccttcaaacg
attaaagaggacatgaatgagacaaacaaaacggcctctcttgcggtgatagctgaatac
aatgagaaaatgaaaaatcttcgttttcagcagtatacatcatctaatcgcattaagaag
cacgagcgaaaagtccgtgcgcagggggttaaggctgagcaagaggcgctgatgaaaatg
ctggagcggggagacatcccggaagaaacagcaaatgtgctgcaagaacgatttaacgag
ttggaaattttgtatgccaacccgtttaaagtcgggttatcaaaaacaaggctcaagagg
ctgatgtattggattttcttcggtgaacataaaaagccggagatgtcgattttaaatgaa
gcgggattgatacgggcaacaagagtgaaaacggcaaaagcagcgatagaatatctggaa
aaacataagacggatgagcataaagaagtgtttttatctgtcattacattctataagcag
ttaattttcaggctggagcacagccatcatgagttaaaatcaagtgcccattttgaaaat
cagaagctggaagtgaagctgaaggctgtgcaggcgatcagaaatgaaattcaaacgctc
ttcgaagagagggaaatttcccgggacatctcccatgagcttcgccaatacattaatgat
gtcgaagccgccatgcttgaaggcggcgaataa

DBGET integrated database retrieval system