KEGG   Bacillus subtilis subsp. subtilis 168: BSU33430
Entry
BSU33430          CDS       T00010                                 

Symbol
yvgQ
Name
(RefSeq) sulfite reductase [NADPH] hemoprotein beta-component
  KO
K00381  sulfite reductase (NADPH) hemoprotein beta-component [EC:1.8.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU33430 (yvgQ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     BSU33430 (yvgQ)
SSDB
Motif
Pfam: NIR_SIR NIR_SIR_ferr GcpE
Other DBs
NCBI-GeneID: 938605
NCBI-ProteinID: NP_391223
Pasteur: BG14099
BSORF: BG14099
UniProt: O32213 A0A6M4JP58
Position
complement(3430598..3432313)
AA seq 571 aa
MVTKILKAPDGSPSDVERIKKESDYLRGTLKEVMLDRISAGIPDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVSTPEQWLVMDDLSQKYGNGTLKLTTRETFQMH
GILKWNMKKTIQTIHSALLDTIAACGDVNRNVMCASNPYQSEIHSEVYEWSKKLSDDLLP
RTRAYHEIWLDEERVAGTPEEEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIAI
VEDGKLIGFNVAIGGGMGMTHGDTATYPQLAKVIGFCRPEQMYDVAEKTITIQRDYGNRS
VRKNARFKYTVDRLGLENVKEELENRLGWSLEEAKPYHFDHNGDRYGWVEGIEDKWHFTL
FVEGGRITDYDDYKLMTGLREIAKVHTGEFRLTANQNLMIANVSSDKKEEISALIEQYGL
TDGKHYSALRRSSMACVALPTCGLAMAEAERYLPTLLDKIEEIIDENGLRDQEITIRMTG
CPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEADILSELRILLSRY
AKEREEGEHFGDFVIRAGIIKATTDGTNFHD
NT seq 1716 nt   +upstreamnt  +downstreamnt
atggtgaccaaaattctaaaagcaccggacggctctccaagtgatgttgaacgcattaaa
aaagaaagtgattatttgcgcggcacgctgaaagaagtgatgctcgatcgaatcagtgcg
ggaattccggatgatgataaccgcctgatgaaacaccacggcagttatttgcaggatgac
cgcgacctccgaaatgaacgccaaaagcagaagcttgagcccgcatatcagttcatgctg
cgcgtgcgtatgccagggggcgtctcgacgcctgaacaatggcttgtcatggatgacctg
tcccagaaatacgggaacggcacattaaaattgacgacacgtgaaacattccaaatgcac
ggaattctgaaatggaacatgaagaaaaccattcagacgatccactcagcacttttggat
acgatcgcagcctgcggagacgtaaaccgtaacgtcatgtgtgcatcaaacccttatcaa
tctgaaatccactcagaggtatacgagtggtctaaaaaattaagtgatgatctgctgccg
cggacgagagcatatcatgaaatttggcttgatgaggaaagagttgccggcacgccggag
gaagaagtcgagccaatgtacggaccgctctatctgccgcggaagtttaaaatcggtatt
gccgttccgccgtctaatgatattgacgtcttttcacaagatctcggattcattgcgatt
gtcgaggatggcaagctgatcggttttaacgtggcaatcggcggcggtatgggaatgacg
catggcgatactgcgacatatccgcaattagccaaggtgatcggtttctgccggcctgag
caaatgtatgacgttgctgaaaaaacgattacgattcagcgtgattacggcaaccgttct
gtccgtaaaaatgcgcggttcaaatacacagttgaccgcctcggtttagaaaacgtaaaa
gaagaattggaaaaccgtctcggctggagcctggaagaagcgaagccgtatcatttcgat
cataacggcgaccgctatggctgggtggaaggcatcgaggataaatggcatttcacgctg
tttgtcgaaggcggccgtataacggattacgatgattataagctgatgactggcttgcgg
gaaatcgccaaagttcatacaggtgagttccggctgacagccaatcagaacttaatgatt
gcgaacgtttcaagcgataaaaaagaagaaatcagtgctttaattgaacagtacggacta
actgacggcaagcactattcagcgcttcgccgcagctcgatggcgtgcgtcgctcttccg
acctgcggattggcaatggctgaagcagaacgttatttgccgaccctgttagataagatt
gaagagattattgacgaaaacggccttcgtgatcaggaaatcaccattcgcatgacagga
tgcccgaacggctgtgcacgtcatgcactcggtgagatcggatttatcggaaaggcgccg
ggcaaatataatatgtatcttggcgctgcgtttgacggaagccgtttaagcaaaatgtac
cgtgaaaacatcggtgaagcagacattttaagcgagctgcgcatccttctttcccgctat
gcgaaagaacgcgaggaaggcgagcatttcggtgactttgtcattcgcgcgggcattatt
aaagcaacaactgacggtacgaattttcatgattga

DBGET integrated database retrieval system