KEGG   Bacillus subtilis subsp. subtilis 168: BSU33440Help
Entry
BSU33440          CDS       T00010                                 

Gene name
cysJ
Definition
(RefSeq) sulfite reductase [NADPH] flavoprotein alpha-component
  KO
K00380  sulfite reductase (NADPH) flavoprotein alpha-component [EC:1.8.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU33440 (cysJ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     BSU33440 (cysJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_1 FAD_binding_1 NAD_binding_1 Flavodoxin_5 Flavodoxin_3 SBP_bac_5 FMN_red
Motif
Other DBs
NCBI-GeneID: 936022
NCBI-ProteinID: NP_391224
Pasteur: BG14100
BSORF: BG14100
UniProt: O32214
Position
complement(3432339..3434156)
Genome map
AA seq 605 aa AA seqDB search
MQLQVMNSPFNQEQAELLNRLLPTLTESQKIWLSGYLSAQSVSAQEAAGTPAAAVSAEAP
APAVSKEVTVLYGSQTGNAQGLAENAGKQLEQSGFQVTVSSMSDFKPNQLKKVTNLLIVV
STHGEGEPPDNALSFHEFLHGRRAPKLEDLRFSVLALGDSSYEFFCQTGKEFDQRLEELG
GKRISPRVDCDLDYDEPAAEWLEGVLKGLNEAGGGSAAPAPAAASQTGESSYSRTNPFRA
EVLENLNLNGRGSNKETRHVELSLEGSGLTYEPGDSLGVYPENDPELVELLLKEMNWDPE
EIVTLNKQGDVRPLKEALISHYEITVLTKPLLEQAAQLTGNDELRELLAPGNEENVKAYI
EGRDLLDLVRDYGPFSVSAQEFVSILRKMPARLYSIASSLSANPDEVHLTIGAVRYDAHG
RERKGVCSILCAERLQPGDTLPVYVQHNQNFKLPKDPETPIIMVGPGTGVAPFRSFMQER
EETGAEGKAWMFFGDQHFVTDFLYQTEWQNWLKDGVLTKMDVAFSRDTEEKVYVQHRMLE
HSAELFEWLQEGAAVYICGDEKHMAHDVHNTLLEIIEKEGNMSREEAEAYLADMQQQKRY
QRDVY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacttcaggtaatgaacagtccgtttaatcaggagcaggcagagctccttaaccgc
cttctgccgaccttgaccgaatcccagaaaatctggctgagcggatatttatccgctcaa
tctgtttccgcccaagaagctgcgggtacgccggcggcagctgtgtcagcggaagcaccg
gcaccggccgtttcaaaagaagtgaccgttctttatggttcacagacgggaaacgcacag
gggcttgcagaaaatgccggcaagcagcttgaacagagcggttttcaagtgaccgtctca
tccatgagcgattttaagccgaatcagctgaagaaggtaaccaatcttttaatcgtcgtc
agtacgcatggagaaggcgagccgcctgataacgcgctgtcgtttcatgaatttctgcac
ggaagacgggcgcctaagcttgaagacctgcgcttttccgttttggcgcttggtgacagt
tcgtacgaatttttctgccagacagggaaagaatttgatcaacgcttagaagaactcggc
ggaaaacggatttctccgcgcgttgattgcgatcttgactatgatgaaccggcagccgaa
tggcttgagggtgtattgaaaggattaaatgaagctgggggcggaagcgccgcgcctgcg
ccggcggctgcgtcacaaaccggtgagtcttcgtattccagaacaaacccgtttcgggct
gaagtgttagaaaatttaaatttaaacggcagaggatcaaataaagaaacacgccatgtg
gagctgtctcttgaaggatctggcctgacttacgagcctggtgacagcctcggcgtctat
ccggaaaacgatccggaacttgtcgagctgctccttaaggaaatgaattgggacccggaa
gaaattgtgacgcttaataagcaaggtgatgtccgaccgctgaaagaagcgctgatttct
cactatgagattaccgttctcacaaaaccgcttcttgaacaggcagcccagctgacaggg
aacgatgagcttagagagcttttagccccgggaaatgaggagaatgtaaaagcctatatt
gaagggcgcgatttgcttgatctcgtccgtgactatggcccatttagtgtatctgcgcag
gagtttgtctcgattttgcgaaaaatgcctgcccgcctttattcgattgcaagcagttta
tccgcaaatccggatgaagtgcacttaacaatcggcgcagtccgctacgatgcgcacggc
cgtgaacgaaaaggcgtctgctcgattttgtgcgcggaacgactgcagccgggagacaca
ctgccggtttatgtacagcacaatcaaaactttaagcttccgaaagaccctgaaacaccg
attatcatggtgggccctgggacaggcgtcgcacctttccgttcgtttatgcaggagcgt
gaggagacgggagcggaaggaaaggcatggatgttctttggcgatcagcactttgtcacg
gatttcctttaccagacagagtggcagaattggctcaaagacggtgtgctgacaaaaatg
gatgtggcgttctcacgtgatacggaagaaaaagtatatgtgcagcaccgcatgcttgaa
catagcgcagaattgtttgaatggcttcaagaaggagcggctgtttacatttgcggagat
gaaaagcacatggcgcatgacgtccataacacattgcttgaaattatcgaaaaagaaggc
aatatgagccgcgaagaggcggaggcttatcttgccgatatgcagcagcaaaaacgctat
cagcgtgatgtatattga

DBGET integrated database retrieval system