KEGG   Bacillus subtilis subsp. subtilis 168: BSU33450Help
Entry
BSU33450          CDS       T00010                                 

Gene name
helD
Definition
(RefSeq) helicase IV
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU33450 (helD)
   03430 Mismatch repair
    BSU33450 (helD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU33450 (helD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU33450 (helD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU33450 (helD)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU33450 (helD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C_2 UvrD_C AAA_30 DUF2075 Viral_helicase1 PhoH DEAD Asp_Glu_race AAA_16 ResIII NACHT
Motif
Other DBs
NCBI-GeneID: 936037
NCBI-ProteinID: NP_391225
Pasteur: BG14101
BSORF: BG14101
UniProt: O32215
Position
complement(3434327..3436651)
Genome map
AA seq 774 aa AA seqDB search
MNQQDKEWKEEQSRIDEVLKELEKKERFLETSAGGLKHDIIGLRKSFWEDVKVNFDDAHE
AIETMASIKQQAELLSDREHNHRRMDQQLKRIHQLKKSPYFGRIDFIENGEEQAERIYIG
LASCLDEKEEHFLIYDWRAPISSLYYNYSPGKAEYEVPGETIEGEMVLKRQFMIKNGTLK
AMFNTDMTIGDEMLQEVLSHHSDTQMKNIVSTIQKEQNQIIRNEKSKILIVQGAAGSGKT
SAALQRVAYLLYRHRGVIDAGQIVLFSPNFLFNSYVSSVLPELGEENMEQATFQEYIEHR
LGRKFKCESPFDQLEYCLTETKGGDFPTRLAGITWKAGLSFQQFINEYVTRLSSEGMIFK
NIIFRGQKLITKEQIQSYFYSLDQNHSIPNRMEQTAKWLLSELNKLEKKERRKDWVVHEA
ELLDKEDYLDVYKKLQERKRFSESTFNDYQREQQLLAAIIVKKAFKPLKQAVRLLAFLDV
TQLYLQLFSGWGGKFQHEKMDAIGELTRSAFTDNKLLYEDAAPFLYMQDLIEGRKKNTKI
KHLFIDEAQDYSPFQMAYMRSIFPAASMTVLGDINQSIYAHTINGDQRMDACFEDEPAEY
VRLKRTYRSTRQIVEFTKAMLQDGADIEPFNRSGEMPLVVKTEGHESLCQKLAQEIGRLK
KKGHETIAVICKTAHQCIQAHAHMSEYTDVRLIHKENQPFQKGVCVIPVYLAKGIEFDAV
LVYDASEEHYHTEHDRRLLYTACTRAMHMLAVFYTGEASPFVTAVPPHLYQIAE
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcaggataaggaatggaaggaagagcagtcgagaatagatgaggtgctgaag
gagctcgaaaaaaaagagcggtttctggaaacgtctgcgggcgggttgaagcatgatatc
atcggattaagaaaaagcttttgggaggatgttaaggttaattttgatgatgcccatgaa
gcgattgaaacgatggctagcattaagcagcaggcagagctgctgtctgatcgggaacac
aatcatcggcgcatggatcagcagctcaaacgaattcatcaattgaaaaaatcgccttat
ttcggccggattgattttattgaaaacggcgaggagcaggcagagcgaatttatatcggt
ttagcttcctgtttggatgagaaggaggaacactttctgatctatgactggagggcgccg
atatcaagtttgtactacaattattccccaggaaaagcggagtacgaggtgcccggtgaa
acgatagaaggggaaatggtgctgaaacgccagtttatgatcaaaaacggcactctcaag
gcgatgtttaataccgatatgacgattggcgatgaaatgctgcaagaggtattaagccat
cactctgatacccaaatgaaaaacatcgtgtctacgattcagaaagaacaaaatcagatt
atccgtaatgaaaaaagcaagatcctgatcgtgcagggagcggctggcagcgggaaaaca
tcggctgcgcttcagcgtgtcgcttatttgttatacaggcaccgcggtgtcattgatgcc
ggacaaatcgttttgttttcacccaacttcttatttaacagctatgtctcctctgttttg
ccggagttaggagaagagaatatggagcaggcgacgtttcaggaatatatcgagcatcgt
cttggccgcaagttcaaatgtgaaagcccctttgatcagctcgaatattgcctgaccgaa
acaaagggaggcgattttccaacaaggcttgcaggaatcacatggaaggcgggtttatcc
tttcagcaattcattaatgaatacgtcacacggctttcctctgaagggatgatttttaaa
aatattatattccgcggacaaaagctgatcacaaaggagcaaattcaatcctatttttac
tcattggatcaaaatcactccattccgaatcggatggagcaaaccgcgaagtggctgctg
agtgagcttaacaagcttgagaaaaaggaacggcgaaaggattgggttgttcatgaagct
gagctgcttgacaaagaggactacttggacgtgtacaaaaaactgcaggaaaggaaacgg
ttcagcgagagtacgtttaacgattatcaaagagagcagcagctgcttgccgccatcatt
gtgaaaaaagctttcaaaccgctcaaacaggcagtcaggctccttgcatttcttgatgtt
acacaactttatttgcaattgttttctggctggggaggaaaatttcaacatgagaagatg
gatgcgataggtgagctgacccgttcggcatttacggataataaattgctctatgaggac
gcggcaccgtttctttatatgcaggatctgattgagggcagaaagaaaaatacgaaaatc
aaacatctatttattgacgaagcccaggactattcaccgtttcagatggcttacatgaga
agcatttttccggctgccagcatgacagtgctcggtgatatcaatcagtccatctacgcg
cataccataaacggggatcagcgtatggatgcgtgctttgaggatgagcctgctgagtat
gttcgtttaaagagaacatacagatcaacaaggcagattgtcgagtttaccaaagcgatg
cttcaagatggagcggatattgagccgtttaatagaagcggggaaatgccgctcgttgtc
aaaactgaaggacatgagagcctttgccaaaagctcgcgcaagaaattggccggctcaag
aaaaaagggcacgaaacaatagccgtcatctgcaagactgcgcatcaatgcatacaggcg
cacgcccacatgagtgaatatacagatgttcgcctgattcataaagaaaatcaaccattt
caaaagggtgtttgcgtgattccggtgtatttagcgaagggaattgaatttgacgcagtg
cttgtctatgatgcatctgaagaacactatcatacagagcacgaccgcaggcttttatat
actgcgtgcacccgtgcgatgcacatgctggcggtattttatacaggtgaagccagtccg
tttgtaaccgctgtgccgcctcacttatatcagattgctgaatga

DBGET integrated database retrieval system