KEGG   Bacillus subtilis subsp. subtilis 168: BSU33460
Entry
BSU33460          CDS       T00010                                 

Symbol
yvgT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gly_transporter
Other DBs
NCBI-GeneID: 936011
NCBI-ProteinID: NP_391226
Pasteur: BG14102
BSORF: BG14102
UniProt: O32216 A0A6M3ZGD1
Position
complement(3436849..3437457)
AA seq 202 aa
MAWELLSVIGIIAFAVSGAIVAMEEEYDILGVYILGIVTAFGGGAIRNLLIGVPVSALWE
QGAYFQIALLSITIVFLFPKLLLKHWNKWGNLSDAIGLAAFAIQGALYAVKMGHPLSAVI
VAAVLTGSGGGIIRDLLAGRKPLVLKAEIYAVWAALGGLIVGLGWLGNSFGLYVLFFVLV
VCRVCSYMFNWKLPNRSFRLDN
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcttgggagctgcttagtgtgattggcatcattgcgtttgcagtcagcggcgcaatt
gttgcgatggaagaggaatatgatattttaggagtttatatattagggattgtcacagct
tttggaggaggagcgatccgcaatttgctgatcggtgttccggtgtcagcgctatgggag
cagggagcgtactttcaaatcgcgcttttatctattacaattgtgtttctgtttccgaag
ctgctgctgaagcattggaataagtggggcaatttatcagatgcgatcggcctcgctgcc
tttgctatccaaggcgcactgtatgccgtcaaaatgggccatccgcttagtgccgtgatc
gtggctgcggtgctgacgggaagcgggggcgggatcatccgcgaccttcttgccgggcgc
aaaccgcttgtgctgaaagcggaaatctatgcggtatgggcggcgctcggcggtttaatc
gtcggcttgggctggctggggaactcgttcggcttatacgttctgtttttcgtgctcgtt
gtttgccgggtttgttcctatatgtttaattggaagctgccaaaccgttcttttcgctta
gataattaa

DBGET integrated database retrieval system