KEGG   Bacillus subtilis subsp. subtilis 168: BSU33470
Entry
BSU33470          CDS       T00010                                 

Symbol
bdbC
Name
(RefSeq) disulfide bond formation protein C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DsbB DUF2070
Other DBs
NCBI-GeneID: 936042
NCBI-ProteinID: NP_391227
Pasteur: BG14103
BSORF: BG14103
UniProt: O32217 A0A6M4JP64
Position
complement(3437644..3438060)
AA seq 138 aa
MKNRIVFLYASWVVALIAMLGSLYFSEIRKFIPCELCWYQRILMYPLVLILGIATFQGDT
RVKKYVLPMAIIGAFISIMHYLEQKVPGFSGIKPCVSGVPCSGQYINWFGFITIPFLALI
AFILIIIFMCLLKGEKSE
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaaaaatagaatcgtatttttatatgcttcctgggttgtggctcttatcgctatgctg
ggcagcctgtatttcagtgaaatcagaaagtttattccatgtgaactgtgctggtaccag
cgtatcctcatgtatccgctcgtcctgattttaggcatcgccacctttcaaggggacaca
cgagtgaaaaaatatgtgctcccgatggcgattattggggcattcatttcgatcatgcat
tacttagagcaaaaagtgcccggctttagcggcattaagccatgtgtcagcggcgtgccg
tgctcgggccaatatattaactggtttggttttattacgattccattcctggccctgatt
gcttttatcctgattatcatttttatgtgcctgctgaaaggcgaaaaatctgaataa

DBGET integrated database retrieval system