KEGG   Bacillus subtilis subsp. subtilis 168: BSU33480
Entry
BSU33480          CDS       T00010                                 

Symbol
bdbD
Name
(RefSeq) disulfide bond formation protein D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Thioredoxin_4 DSBA Thioredoxin_2 Thioredoxin_8 Thioredoxin_3 DUF4720 Thioredoxin_5 INV_N Tctex-1
Other DBs
NCBI-GeneID: 936031
NCBI-ProteinID: NP_391228
Pasteur: BG14104
BSORF: BG14104
UniProt: O32218 A0A6M3ZJC8
Structure
Position
complement(3438065..3438733)
AA seq 222 aa
MKKKQQSSAKFAVILTVVVVVLLAAIVIINNKTEQGNDAVSGQPSIKGQPVLGKDDAPVT
VVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKE
DPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKD
SDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK
NT seq 669 nt   +upstreamnt  +downstreamnt
gtgaaaaagaaacagcagtcttctgcgaaattcgcggtcatccttacggttgtggttgtt
gtattgctagcagccattgtcatcattaataacaaaacggaacaaggcaatgatgcggtg
tccggacagccgtctatcaaagggcagcctgtgcttggcaaggacgatgcaccggtaact
gtagtagaattcggagattacaaatgtccgtcttgcaaggtgtttaacagtgacatcttt
ccaaaaatacaaaaagactttattgataagggcgatgtgaaattttctttcgtgaacgtc
atgttccatggaaaaggttcaaggttagcggctcttgcatctgaagaagtatggaaggaa
gaccctgactctttctgggatttccatgaaaagctgttcgaaaaacagccggatacggaa
caggaatgggtaaccccaggcctccttggtgatcttgcaaaaagcaccacaaagataaaa
cctgagacgctcaaggaaaatcttgataaggaaacattcgcttctcaagtggaaaaggat
tctgaccttaatcaaaaaatgaacatacaggcaacaccgacgatttacgtcaatgataaa
gtgatcaaaaattttgcggattatgatgaaatcaaagagacaatagaaaaagagctgaaa
gggaagtaa

DBGET integrated database retrieval system