KEGG   Bacillus subtilis subsp. subtilis 168: BSU33490Help
Entry
BSU33490          CDS       T00010                                 

Gene name
copB
Definition
(RefSeq) copper(I)-transporting ATPase
  KO
K01534  Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 7.2.2.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU33490 (copB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     BSU33490 (copB)
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     BSU33490 (copB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 936034
NCBI-ProteinID: NP_391229
Pasteur: BG14105
BSORF: BG14105
UniProt: O32219
Position
complement(3438853..3440952)
Genome map
AA seq 699 aa AA seqDB search
MKQEYVLDGLDCSNCARKIENGVKGIKGINGCAVNFAASTLTVSADGKEEQWVTNKVEKK
VKSIDPHVTVRQKHIKKSADDGYRNRMVNMLIRMAAAVILGAAAYLVQSGTIEFFLFLGA
YLIIGGDIIIRAVKNIIRGQVFDEHFLMALATIGAFLIQQYPEGVAVMLFYQIGELFQGA
AVSRSRKSISALMDIRPDYANLKTKNGIEQVSSEDVQTGDIIVVNPGESIPLDGKVVQGS
AMVDTSALTGESVPRKAAEGQDVMSGFINQNGVLHIEVTKGYQESAVSKILDLVQNASSR
KARTENFITKFAKYYTPAVVIIAVLLAFVPPLVLSGAALSDWVYRALIFLVISCPCALVV
SIPLGFFGGIGAASKAGVLVKGSNYLEALNQVKYAVFDKTGTLTKGSFEVTEIKPAEGFT
KDRLLEAAAYAELHSQHPIAESVRKAYGKMLSSDEIESYEEISGHGIFAKVNGTEILAGN
KKLMEREQIEDVPDENAGTIVHVAVDQRYAGAIIIADEIKEDAAQAVADLKSLGIKQTAM
LTGDSKQTGEAVGKQLGIGEVYAELLPQDKVAQVEALEAKLLPSEKLIFVGDGINDTPVL
ARADIGVAMGGLGSDAAVEAADIVLMTDQPSKIAEAIRIAKRTRRIVWQNIGFALGVKAI
FLILGAFGIATMWEAVFSDVGVTLLAVANAMRVMRLKNK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaggaatatgttctggacggtttggattgcagcaattgtgcccgaaaaatcgaa
aatggagtcaaaggcataaaaggcattaacggatgcgcggtaaattttgcggcaagcacc
ttaactgtctcagccgatgggaaagaagagcaatgggtcacgaataaagtagagaaaaaa
gtgaaatcaattgatccgcatgtaacggttcgccaaaagcatataaagaaatcagctgat
gatggctatcgtaatcgaatggtcaatatgctgatcagaatggcggcggctgtcattctc
ggcgcagcggcatatttggttcagtcgggaaccattgaatttttccttttcctcggtgct
tatttgattatcggcggtgacattataatccgcgcagtcaaaaacatcatccgcggtcag
gtgtttgatgagcatttcttaatggctcttgccacaatcggcgcttttctgattcagcaa
taccctgagggggtcgccgttatgctgttttatcaaatcggtgagctttttcaaggagcc
gcggtcagccgttccagaaaatcaattagtgcgttaatggacatacggcctgattacgcc
aatctcaaaacaaagaacggcatcgaacaggtttcgtcggaggacgttcagacaggagac
atcattgtggttaatccgggagaaagcatacccctggacggtaaggtcgtgcaagggtca
gcgatggttgatacatctgctttaacaggtgagtccgttccgagaaaagctgcggaagga
caagatgtaatgtcaggctttatcaatcaaaacggcgttctgcatattgaagtcacaaag
ggctatcaggaatcagcagtatcaaaaatattagacttggttcagaatgcgagcagccgt
aaagcccggacagaaaactttatcacgaagtttgccaagtattatacacctgctgtggtg
atcattgcggtattgctggcctttgttccgccgcttgttctttctggcgccgcgctttcc
gattgggtgtaccgcgcgcttatctttttagtgatttcttgtccttgtgcgcttgttgtc
tctattccgctcggtttcttcggtggaatcggagcggcctcaaaggccggagtgcttgta
aagggaagcaattatttagaagctttgaatcaagtcaaatacgcggtgtttgataaaacg
ggaacactaacaaaaggcagctttgaagtgacagaaatcaaacccgcggaaggttttaca
aaggatagattacttgaagcggcggcatacgctgagcttcattcacagcatccgattgct
gaatctgtgcgtaaagcttacgggaaaatgctttcctccgatgagattgagtcatacgaa
gaaatctccggtcacggcatttttgcaaaggtaaatggaactgagatccttgctgggaat
aaaaagctcatggaaagagaacaaattgaggatgtcccggatgaaaatgctggaacaatc
gtacacgttgctgtagatcaacgctatgccggagcaatcatcatagcggatgagataaag
gaagacgcagcacaggcggttgctgatctgaagtcgcttgggatcaaacagacagctatg
ctgacgggtgattcgaaacaaacgggagaagccgtcggaaaacagcttgggattggtgag
gtatatgcagagctgctgccgcaagataaagtcgcgcaggtcgaagcattagaagctaag
cttttgcctagtgaaaaactcatttttgtcggtgacggcatcaatgatacgccggtgctt
gcacgcgcagatataggggttgcgatgggaggccttggctcagacgccgcggtagaagcc
gcagacatcgtgctgatgacagatcagccgtcaaaaatagcagaagcgattcggattgcg
aaacggacacggcgaatcgtgtggcaaaacatcggctttgctttaggtgtgaaagcgatc
tttctcattcttggtgcatttggaattgcgaccatgtgggaagcggttttctcagatgtc
ggcgttacactgcttgctgtggcgaacgccatgcgcgtcatgcgtctcaaaaacaaataa

DBGET integrated database retrieval system