KEGG   Bacillus subtilis subsp. subtilis 168: BSU33500Help
Entry
BSU33500          CDS       T00010                                 

Gene name
copA
Definition
(RefSeq) copper-exporting P-type ATPase A
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     BSU33500 (copA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 HAD YscJ_FliF Tox-PL-2
Motif
Other DBs
NCBI-GeneID: 937985
NCBI-ProteinID: NP_391230
Pasteur: BG14106
BSORF: BG14106
UniProt: O32220
Structure
PDB: 

Position
complement(3441121..3443529)
Genome map
AA seq 802 aa AA seqDB search
MSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETSNVIYDPAETGTAAIQ
EKIEKLGYHVVTEKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPK
EASVSDLKEAVDKLGYKLKLKGEQDSEAAAKKKEERKQTARLIFSAVLSFPLLWAMVSHF
TFTSFIWVPDIFLNPWMQFALATPVQFLIGWPFYVGAYKALRNKSANMDVLVALGTTAAY
AYSLYLTFQSIGSHGHTDGLYYETSAILLTLILLGKLFETKAKGRSSDAIKKLMKLQAKT
ATVVRDGQEQIIPIDEVLVNDIVYVKPGERIPVDGEVVEGRSAVDESMITGESLPVDKNP
GDSVTGSTVNANGFLKIKAVNVGKDTALSHIIKIVEEAQGSKAPIQRLADQISGIFVPIV
LGIAVLTFLIWYLWAAPGDFAEAISKFIAVLVIACPCALGLATPTSIMAGSGRAAEFGIL
FKGGEHLEKTHRLDTIVLDKTGTVTNGKPRLTDAIPFGRFEEKDLLQFAAAAETGSEHPL
GEAIIAGVKDKGLEIPKLTRFEAKVGAGILAEAGGKSILVGTRKLMESEQVEHGALLAQM
EELEAEGKTVMLVSIDGEAAGLVAVADTIKDTSRKAVARLKELGLDVIMMTGDNRRTAEA
IAKEAGIANIIAEVLPEQKAAEIARLQKEGRQTAMVGDGINDAPALATADIGMAIGTGTD
IAMETADITLIRGDLNSIADAIRMSRLTMKNIKQNLFWALGYNSLGIPIAALGFLAPWIA
GAAMAFSSVSVVLNALRLQKVK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaacaaaaggaaatcgcgatgcaggtctctggtatgacctgtgcggcatgtgct
gccagaattgaaaaaggcctgaagcggatgcccggtgtcacggatgcaaatgttaatctg
gcaacggaaacatcaaatgtaatctacgatcctgctgaaacagggactgcagcgattcag
gaaaaaatagagaagctgggctatcacgtcgttacagaaaaagctgaattcgatattgag
ggcatgacctgtgcggcttgcgccaatcggattgaaaaacggcttaacaaaatagaaggc
gtcgcaaatgcaccagtaaacttcgctttagaaacagttacggtcgaatacaatccaaaa
gaagcgtctgtcagcgatttgaaagaagcggtagataagcttggatataagctaaagttg
aagggtgaacaggacagtgaggctgctgctaaaaagaaagaagaacggaagcaaacggcg
agactgattttttcagctgtcctgtcatttccattgctttgggcgatggtgagccatttt
acatttacatcattcatttgggtaccggatatatttctcaatccgtggatgcagtttgcg
ctggcgacaccagtccagtttctgatcggctggccgttttatgtgggtgcgtataaggcg
cttagaaataaaagcgccaatatggatgtattggtcgccctcggtacgacggctgcttac
gcttatagtctttatctaacttttcaaagcattggctctcacgggcatacagacggcctt
tattatgaaacaagcgcgattttgctgacgctgattttattaggcaagttgtttgaaaca
aaagcaaaaggccgttcctcggatgcgattaaaaagctgatgaagcttcaagcgaaaaca
gctactgttgtaagagacggacaggagcaaatcatcccgatcgacgaagtgcttgttaat
gacattgtttacgtcaaacctggcgaacgaattcctgtcgacggagaagtggttgaaggc
cgttcagcggttgacgaatcgatgattacaggagaaagtcttcctgttgacaaaaatcct
ggtgacagcgtgacaggttcaaccgttaacgcaaacggctttctgaaaattaaagctgtc
aacgtcggaaaggatactgcgctttctcatatcatcaaaattgttgaggaagcacaaggg
tcaaaagcgccgatccagcgtctcgctgaccagatttcaggcatttttgtacccattgta
ttggggattgcggttctcacttttctcatttggtatctttgggcggctcctggcgatttt
gccgaagcgatcagcaagttcattgcggttcttgtcattgcctgtccttgcgccctcggt
cttgccactccgacgagcataatggctggatctggacgcgctgctgaattcgggatttta
tttaaaggcggcgagcatttagaaaaaacacatcgtctcgatacaattgttcttgataaa
accggaaccgtgacaaacgggaagccgcgtctgacggatgccattccattcggccgtttt
gaagaaaaagatttgcttcaatttgcagcggcagcggaaacgggatcagagcatccgctt
ggcgaagcgattattgctggcgtgaaagataaagggcttgagataccgaaacttacccgc
tttgaagcaaaagtcggcgcaggcattttggctgaagccggaggaaaaagcattctcgtc
ggcacaagaaaattaatggagagcgaacaggttgagcatggggctcttctcgcccaaatg
gaagagctagaggccgaagggaaaacagttatgcttgtatccattgatggagaagcagcg
gggctagtagcagttgcagatacgattaaggatacgtcgcggaaggctgttgcccgtctg
aaagagttgggtcttgatgtcatcatgatgacaggagacaatcgcagaaccgcagaagcc
atcgcgaaggaagcgggaattgcgaatatcattgcggaagttcttcctgaacaaaaggcg
gcggaaatcgcccgcttgcaaaaagaaggccgccagacagcaatggtaggcgacggaatt
aacgatgcgccggcgcttgccacagctgacatcggcatggcgattggaactggcacggac
attgccatggaaacagcagacattacacttattcgcggcgatctgaacagcattgccgac
gcaatccgcatgagcagattgacaatgaaaaacattaaacaaaacttattctgggcgctt
ggctataacagcctcggcatcccaatcgcagcacttggatttttagcaccgtggatagca
ggagcagcaatggcattcagctccgtttccgttgttctgaatgctcttcgtctgcaaaaa
gtaaaatga

DBGET integrated database retrieval system