KEGG   Bacillus subtilis subsp. subtilis 168: BSU33510Help
Entry
BSU33510          CDS       T00010                                 

Gene name
copZ
Definition
(RefSeq) copper chaperone CopZ
  KO
K07213  copper chaperone
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMA Ribosomal_L9_C
Motif
Other DBs
NCBI-GeneID: 937974
NCBI-ProteinID: NP_391231
Pasteur: BG14107
BSORF: BG14107
UniProt: O32221
Structure
PDB: 

Position
complement(3443613..3443822)
Genome map
AA seq 69 aa AA seqDB search
MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAI
EDQGYDVAK
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaacattgcaagttgaaggaatgtcttgtcagcactgcgtcaaagcagta
gaaacaagcgtaggagaactggacggcgtcagtgccgttcatgtcaatctggaagcgggt
aaagtcgatgtttcgtttgatgctgacaaagtatcagtcaaagatattgcggatgcgata
gaagatcagggctatgacgtagccaagtga

DBGET integrated database retrieval system