KEGG   Bacillus subtilis subsp. subtilis 168: BSU33510
Entry
BSU33510          CDS       T00010                                 

Symbol
copZ
Name
(RefSeq) copper chaperone CopZ
  KO
K07213  copper chaperone
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HMA DUF6286
Other DBs
NCBI-GeneID: 937974
NCBI-ProteinID: NP_391231
Pasteur: BG14107
BSORF: BG14107
UniProt: O32221 A0A6M3ZKU2
Structure
PDB: 
2QIF 3I9Z 1P8G 1K0V

Position
complement(3443613..3443822)
AA seq 69 aa
MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAI
EDQGYDVAK
NT seq 210 nt   +upstreamnt  +downstreamnt
atggaacaaaaaacattgcaagttgaaggaatgtcttgtcagcactgcgtcaaagcagta
gaaacaagcgtaggagaactggacggcgtcagtgccgttcatgtcaatctggaagcgggt
aaagtcgatgtttcgtttgatgctgacaaagtatcagtcaaagatattgcggatgcgata
gaagatcagggctatgacgtagccaagtga

DBGET integrated database retrieval system