KEGG   Bacillus subtilis subsp. subtilis 168: BSU33520
Entry
BSU33520          CDS       T00010                                 

Symbol
csoR
Name
(RefSeq) copper-sensing transcriptional repressor CsoR
  KO
K21600  CsoR family transcriptional regulator, copper-sensing transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33520 (csoR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU33520 (csoR)
SSDB
Motif
Pfam: Trns_repr_metal
Other DBs
NCBI-GeneID: 936038
NCBI-ProteinID: NP_391232
Pasteur: BG14108
BSORF: BG14108
UniProt: O32222 A0A6M4JP72
Position
complement(3443896..3444201)
AA seq 101 aa
MEKHNEHKTLNHKSSKEKDQITNRLKRIEGQVRGIQNMVENDRYCVDILVQISAVQAAMK
NVALHLLEDHAHHCVADAIKSGDGEQAISELLDVFKKFTKS
NT seq 306 nt   +upstreamnt  +downstreamnt
atggaaaagcataacgaacataaaacattaaaccataaaagctcgaaagaaaaggatcag
attacaaaccggcttaagcggattgagggccaggtcagaggcattcaaaacatggtggaa
aacgacagatattgtgtagatattcttgtgcaaatttcagctgttcaggcggcaatgaaa
aatgtggcgcttcatttgcttgaggatcatgcccatcattgtgtagcagatgccatcaaa
agcggagacggggaacaggccatttctgagcttttggacgtatttaaaaagttcacaaaa
tcataa

DBGET integrated database retrieval system