KEGG   Bacillus subtilis subsp. subtilis 168: BSU33530
Entry
BSU33530          CDS       T00010                                 

Symbol
yvaA
Name
(RefSeq) oxidoreductase
  KO
K16044  scyllo-inositol 2-dehydrogenase (NADP+) [EC:1.1.1.371]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU33530 (yvaA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.371  scyllo-inositol 2-dehydrogenase (NADP+)
     BSU33530 (yvaA)
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA NAD_binding_3 DapB_N CoA_binding
Other DBs
NCBI-GeneID: 936109
NCBI-ProteinID: NP_391233
Pasteur: BG14057
BSORF: BG14057
UniProt: O32223 A0A6M4JP71
Structure
PDB: 
3GDO 3GFG

Position
3444329..3445405
AA seq 358 aa
MITLLKGRRKVDTIKVGILGYGLSGSVFHGPLLDVLDEYQISKIMTSRTEEVKRDFPDAE
VVHELEEITNDPAIELVIVTTPSGLHYEHTMACIQAGKHVVMEKPMTATAEEGETLKRAA
DEKGVLLSVYHNRRWDNDFLTIKKLISEGSLEDINTYQVSYNRYRPEVQARWREKEGTAT
GTLYDLGSHIIDQTLHLFGMPKAVTANVMAQRENAETVDYFHLTLDYGKLQAILYGGSIV
PANGPRYQIHGKDSSFIKYGIDGQEDALRAGRKPEDDSWGADVPEFYGKLTTIRGSDKKT
ETIPSVNGSYLTYYRKIAESIREGAALPVTAEEGINVIRIIEAAMESSKEKRTIMLEH
NT seq 1077 nt   +upstreamnt  +downstreamnt
ttgataacgcttttaaaggggagaagaaaagtggatacgatcaaggttggaatattagga
tacggattgtccggttctgtttttcacgggccgctgctggatgttctggatgaatatcaa
atcagcaaaatcatgacatcacggacagaagaagtgaaacgggattttccagatgctgag
gttgtacatgagcttgaagaaatcacaaatgaccctgccattgagcttgtcattgtcacc
accccgagcggccttcattacgagcatactatggcatgcatacaggccggaaaacatgtt
gtgatggaaaaaccaatgacagcaacggccgaagagggggaaacattaaaaagggctgcc
gatgaaaaaggcgtattattaagcgtatatcataaccgacgctgggataacgatttttta
acgattaaaaagctgatctctgagggatcccttgaagatatcaatacatatcaagtttcc
tataaccgctacagacctgaagttcaagcgcggtggcgggaaaaagaaggcactgccact
ggtacgctgtatgatctcggctcccacatcatagaccaaaccctgcatttgtttgggatg
cctaaagccgtgactgcaaacgtgatggcccagcgggaaaatgccgaaacggttgactat
tttcatttaaccctggattatggcaagcttcaagccattctatacggaggatcaatcgtt
ccggcaaacggacctcgttatcaaatccatggaaaagattctagctttatcaaatatgga
attgacggacaggaagacgcactcagagcgggaagaaaaccagaggatgacagctggggt
gcggatgttccggagttttacggaaagcttacaaccattcgtggctccgacaaaaaaaca
gaaacgattccatcagtaaatggctcctaccttacttattaccgtaaaatagcggaaagc
atacgagaaggtgctgcgctgccagtcactgctgaggaaggtattaatgtcatccgcatc
attgaagccgcgatggaaagcagtaaagagaaacgaaccattatgctggagcactaa

DBGET integrated database retrieval system