KEGG   Bacillus subtilis subsp. subtilis 168: BSU33540
Entry
BSU33540          CDS       T00010                                 

Symbol
yvaB
Name
(RefSeq) FMN-dependent NADH-azoreductase 2
  KO
K01118  FMN-dependent NADH-azoreductase [EC:1.7.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU33540 (yvaB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.17  FMN-dependent NADH-azoreductase
     BSU33540 (yvaB)
SSDB
Motif
Pfam: Flavodoxin_2 FMN_red
Other DBs
NCBI-GeneID: 936142
NCBI-ProteinID: NP_391234
Pasteur: BG14058
BSORF: BG14058
UniProt: O32224 A0A6M4JP80
Position
complement(3445442..3446077)
AA seq 211 aa
MAKVLYITAHPHDEATSYSMATGKAFIESYKEANPNDEVVHIDLYKENIPHIDADVFSGW
GKLQSGTGFEELSESEKAKVGRLGELSDQFASADKYVFVTPLWNFSFPPVMKAYLDSVAV
AGKSFKYTEQGPVGLLTDKKAIHIQARGGYYSEGPAAEMEMGHRYIGIMMNFFGVPSFDG
IFVEGHNAEPDKAQQIKEDAIARAKEAGKTF
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcaaaagtattatatatcactgctcatccacatgacgaagcaacttcgtacagtatg
gcaacaggtaaagcatttatcgaatcttacaaagaagcgaatccaaatgatgaagttgta
catatcgatttgtacaaagaaaacattccgcacattgacgcagatgtatttagcggatgg
ggaaagcttcagtcaggtacaggctttgaagagctttctgaaagcgaaaaagcgaaagta
ggccgtttgggagagcttagcgatcaatttgcatcagctgataagtacgtatttgttact
cctttatggaacttctcattcccgccagtgatgaaagcgtatctcgattctgttgctgtt
gcaggaaaatcattcaaatacacagaacaaggtcctgtcggcttgttaactgataaaaaa
gcaattcatatccaagcgcgcggcggctactattcagaaggccctgcggctgagatggaa
atggggcaccgctacatcggcatcatgatgaacttcttcggcgtaccatcattcgatggc
attttcgtagagggacataatgcggagcctgataaagcacagcaaatcaaagaagacgcg
attgcgcgtgcgaaagaagcaggaaaaacattctaa

DBGET integrated database retrieval system