KEGG   Bacillus subtilis subsp. subtilis 168: BSU33550
Entry
BSU33550          CDS       T00010                                 

Symbol
yvaC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FUSC_2 FUSC Dsc3_C
Other DBs
NCBI-GeneID: 936143
NCBI-ProteinID: NP_391235
Pasteur: BG14059
BSORF: BG14059
UniProt: O32225 A0A6M4JP82
Position
complement(3446237..3448132)
AA seq 631 aa
MNKTAANNQRIMPIVKDAFRIHANPFPWKKAIGSGFASGFPVLVGALAGHTDYGLIASIG
GFVYLYAGGESYKKRALKLLLVSIGIALSFGLGTLLSGMLWMMAAVLGLIGAAAMFIFSA
LGIQGPAPMFFVLAFLVSSGLPADPSQALFRAGLTFLGGIFAMGIALIGWLWNKHGPEGA
VLQKTYHQLAACLSAVGTPGFHNAQHQTVLMLRTARQTVLGKGNRRKKSRHDERFFRLLE
KADDIFIAIIHFSAETPDRETAQIEKALRQTGDMLANARVFNTFQINENESEPRRKLFEE
INEVLYIASGRFDKQLDGEPSRLPSSFYFLRNAFDWKSPVLIRALKYGIVLFAADMFALA
FGFARSYWIPLSAAAVMLGTTVVFTLHRAIQRSAGTVIGVILAGAILFFKPGGVYIAFCI
AALQCLLEMLIVRNYALAVPFLTANALVITESMHGGAGAGYFMIARLTDVAVGSVIGLLG
TMLLWRRFSTKRLPELVRNVIRLEGQFMEKLLTGQIADEHKLRVSLVRLRDAYDKALGEF
PHANADALWPAISGAQHLGYYLLSAQAHRRPSAPFSDEEINQLRAFFEQAEQSFIMKRMP
ADIQVPHVPHYPRISKELSALYSGLRTAFEK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaacaaaactgctgcgaacaatcaaagaatcatgcctatcgtgaaggatgcctttcgc
attcatgcaaatccatttccttggaaaaaggctatcggatcaggtttcgcttcagggttt
cctgtgctggtcggtgcattggcaggtcacacggattacggattaattgcaagtatcgga
ggctttgtttatttatatgcgggcggtgaatcgtacaaaaagcgcgccttgaagctgctc
ttggtttctattgggatcgccctctcatttggtttagggacgcttttgtccgggatgctt
tggatgatggcggctgttttggggctgatcggtgcagcggcgatgtttatttttagcgcg
ctcggcattcaaggccctgcgccgatgttttttgtccttgcctttttagtcagttccggg
ctgccggccgatccttcacaagcgctgttcagagcgggactgacgtttctcggcggcatt
ttcgccatgggtatcgctttaatcggctggttatggaacaaacatggaccggagggagcg
gtgctgcaaaaaacatatcatcagctggctgcatgtctttcagccgtcggaacgccaggt
tttcataacgcacagcatcagacggtgctcatgcttagaacagcccgccaaacggttctt
gggaaagggaacagacggaaaaaatcgcggcatgatgaacgattttttcgcctccttgag
aaagctgacgacatatttattgccattattcatttttcagctgaaacgccggacagagag
accgcgcagattgaaaaggcacttcgccaaaccggagatatgcttgcgaatgcacgggtt
ttcaatacgtttcagattaatgaaaatgaatctgagcctaggcggaagctgtttgaagaa
atcaatgaggttttgtatatcgcttcaggacgttttgataagcagcttgacggggaacca
agccgcctgccatcctctttttactttttgagaaatgcctttgactggaagtctccagtt
ttgattagagcgttaaagtacggaattgttctgtttgccgccgatatgtttgccctcgca
ttcggctttgcacgctcctattggattccgctttcggcagcagcggtcatgcttggcact
actgttgtttttacgcttcacagggctattcagcgttcggccggaacggtgatcggtgtt
atactggcaggcgcaatcctgttttttaagccgggcggtgtttatattgcgttttgtatt
gcagcgctgcaatgtcttcttgagatgctgatcgtccgcaattatgcgctggctgttccc
tttttaaccgcaaatgcgcttgttatcacagaaagtatgcatggcggggcgggcgccggt
tattttatgatagcgaggctgactgatgtagctgtcggcagcgtgatcgggctgttggga
acaatgcttttgtggcggcggttttcaaccaagcggctgccagaacttgtgcggaatgtc
atccggctggaagggcagtttatggagaaactgttaaccgggcaaattgccgacgaacac
aagttaagggtgagtcttgtcaggcttcgggatgcgtatgacaaggcgcttggcgagttt
cctcacgcgaatgcggatgcgctctggcctgccatttccggtgctcagcacttagggtac
tatttgctctcggcgcaagctcaccgccgtccgtctgctccgttttctgatgaagagatc
aaccagctgcgggcgttttttgaacaggctgagcaatcctttatcatgaaaaggatgcct
gcggatattcaagtgccgcatgtccctcattatcctcggatcagtaaagaattgtccgcg
ctgtattccggcttgagaacagcttttgaaaagtaa

DBGET integrated database retrieval system