KEGG   Bacillus subtilis subsp. subtilis 168: BSU33560
Entry
BSU33560          CDS       T00010                                 

Symbol
yvaD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5360
Other DBs
NCBI-GeneID: 936144
NCBI-ProteinID: NP_391236
Pasteur: BG14060
BSORF: BG14060
UniProt: O32226 A0A6M3ZG22
Position
complement(3448295..3448696)
AA seq 133 aa
MRYMKLFFLVTDIGFILYWLSAGFSLIPESWAFKHHDHPFMIAWNWSFFPLDILISVTGL
YSLYLQRVNRADWKLMALISLVLTCCSGLQALSFWTFSSDFDLVWWLFNGYLLIYPLFFI
HLLLKEGRRTKQS
NT seq 402 nt   +upstreamnt  +downstreamnt
atgagatatatgaagctgttttttctcgtgactgatatcggttttatcttgtactggctg
tcagccggattttcgctcataccggaaagctgggcttttaaacatcatgaccatccgttt
atgatcgcttggaactggtctttttttccgctggatatcctgatttctgtcacagggttg
tacagcttgtacctacagcgggtgaatcgtgctgactggaagctgatggcgctgatttct
cttgtgctgacctgttgttcaggtctgcaggcgctatcattctggacattcagcagtgac
tttgatcttgtgtggtggctgtttaatgggtatctattgatttatcctttattttttatt
cacctgctcttgaaggaaggcagaaggacaaaacagtcctga

DBGET integrated database retrieval system